KEGG   Mus musculus (mouse): 18973
Entry
18973             CDS       T01002                                 

Gene name
Pole, po
Definition
(RefSeq) polymerase (DNA directed), epsilon
  KO
K02324  DNA polymerase epsilon subunit 1 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18973 (Pole)
   03410 Base excision repair
    18973 (Pole)
   03420 Nucleotide excision repair
    18973 (Pole)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18973 (Pole)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18973 (Pole)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18973 (Pole)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    18973 (Pole)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      18973 (Pole)
SSDB
Motif
Pfam: DUF1744 DNA_pol_B_exo1 DNA_pol_B DNA_pol_B_exo2 RNase_H_2 APP_N
Other DBs
NCBI-GeneID: 18973
NCBI-ProteinID: NP_035262
MGI: 1196391
Ensembl: ENSMUSG00000007080
Vega: OTTMUSG00000026219
UniProt: Q9WVF7 Q80XH7 Q3UR94
Position
5 F; 5 53.45 cM
AA seq 2283 aa
MVLRNSGRRHPEPGADGEGSRDDGPSSSVSALKRLERSQWTDKMDLRFGFERLKEPGERT
GWLINMHPTEILDEDKRLVSAVDYYFIQDDGSRFKVALPYMPYFYIAARKGCDREVSSFL
SKKFQGKIAKLENVPKEDLDLPNHLVGLKRSYIKLSFHTVEDLVKVRKEISPAVKKNREQ
DHASDEYTTMLSSILQGGSVITDEDETSKKIADQLDNIVDMREYDVPYHIRLSIDLRIHV
AHWYNVRFRGNAFPVEITRRDDLVERPDPVVLAFDIETTKLPLKFPDAETDQIMMISYMI
DGQGYLITNREIVSEDIEDFEFTPKPEYEGPFCVFNEPDEVHLIQRWFEHIQETKPTIMV
TYNGDFFDWPFVEARAAIHGLSMYQEIGFQKDSQGEYKAPQCIHMDCLRWVKRDSYLPVG
SHNLKAAAKAKLGYDPVELDPEDMCRMATEQPQTLATYSVSDAVATYYLYMKYVHPFIFA
LCTIIPMEPDEVLRKGSGTLCEALLMVQAFHANIIFPNKQEQEFNKLTDDGHMLDAETYV
GGHVEALESGVFRSDIPCRFRMNPAAFDFLLQRVEKTMRHAIEEEEKVPVEQATNFQEVC
EQIKTKLTSLKDVPNRIECPLIYHLDVGAMYPNIILTNRLQPSAIVDEATCAACDFNKPG
ASCQRKMAWQWRGEFMPASRSEYHRIQHQLESEKFPPLFPEGPARAFHELSREEQAKYEK
RRLADYCRKAYKKIHVTKVEERLTTICQRENSFYVDTVRAFRDRRYEFKGLHKVWKKKLS
AAVEVGDASEVKRCKNMEILYDSLQLAHKCILNSFYGYVMRKGARWYSMEMAGIVCFTGA
NIITQARELIEQIGRPLELDTDGIWCVLPNSFPENFVIKTTNAKKPKLTISYPGAMLNIM
VKEGFTNHQYQELTEPSSLTYVTHSENSIFFEVDGPYLAMILPASKEEGKKLKKRYAVFN
EDGSLAELKGFEVKRRGELQLIKIFQSSVFEAFLKGSTLEEVYGSVAKVADYWLDVLYSK
AANMPDSELFELISENRSMSRKLEDYGEQKSTSISTAKRLAEFLGDQMVKDAGLSCRYII
SRKPEGSPVTERAIPLAIFQAEPTVRKHFLRKWLKSSSLQDFDIRTILDWDYYIERLGSA
IQKIITIPAALQQVKNPVPRVKHPDWLHKKLLEKNDIYKQKKISELFVLEGKRQIVMAQA
SENSLSLCTPDMEDIGLTKPHHSTVPVATKRKRVWETQKESQDIALTVPWQEVLGQPPSL
GTTQEEWLVWLQFHKKKWQLQAQQRLALRKKQRLESAEDMPRLGPIREGPSTGLGSFLRR
TARSIMDLPWQIIQISETRQAGLFRLWAIIGNDLHCIKLSIPRVFYVNQRVAKAEDGPAY
RKVNRALPRSNIVYNLYEYSVPEDMYQEHINEINTELSVPDIEGVYETQVPLLFRALVQL
GCVCVVNKQLTRHLSGWEAETFALEHLEMRSLAQFSYLEPGSIRHIYLYHHTQGHKALFG
VFIPSQRRASVFVLDTVRSNQMPGLSALYSSEHSLLLDKVDPKLLPPPKHTFEVRAETNL
KTICRAIQRFLLAYKEERRGPTLIAVQSSWELCRLTSEIPVLEEFPLVPIRVADKISYAV
LDWQRHGARRMIRHYLNLDLCLSQAFEMSRYFHIPVGNLPEDISTFGSDLFFARHLQHHN
HLLWLSPTSRPDLGGKEADDNRLVMEFDDRATVEINSSGCYSTVCVELDIQNLAVNTILQ
SHHVNDMEGAGSMGISFDVIQQASLEDMVTGNQAASALANYDETALCSSTFRILKSMVVG
WVKEITQYHNIYADNQVMHFYRWLQSPCSLLHDPALHRTLHNMMKKLFLQLIAEFKRLGS
SVVYANFNRIILCTKKRRIEDALAYVEYITNSIHSKEIFHSLTISFSRCWEFLLWMDPSN
YGGIKGKVPSSIHCGQVKEQDSQAREETDEEEEDKEKDEEEEGMGESEVEDLLENNWNIL
QFLPQAASCQSYFLMIVSAYIVAVYQSMKEELRHSAPGSTPVKRKGASQFSQESEGATGS
LPGMITFSQDYVANELTQSFFTITQKIQKKVTGSRNTTEPSEMFPVLPGSHLLLNNPALE
FIKYVCKVLSLDTNITNQVNKLNRDLLRLVDVGEFSEEAQFRDPCHSYVLPEVICHSCNF
CRDLDLCKDSSFSQDGAILPQWLCSNCQAPYDSSAIESALVEALQRKLMAFTLQDLVCLK
CRGMKETHMPVYCSCAGDFTLTIRTEVFMEQIRIFQNIAKYYSMSYLQETIEWLLQTSPV
SNC
NT seq 6852 nt   +upstreamnt  +downstreamnt
atggtcctgaggaacagtggacggaggcaccccgagccgggcgcggatggcgaaggcagc
cgggatgatggtccctcttcctcagtctcagcactcaagcgtctggaacggagccagtgg
acagacaagatggacttacggtttggtttcgaaaggctgaaagagcctggagaaaggact
ggctggctgatcaacatgcaccctactgagatcttagatgaagacaaacgcttagtcagc
gcggtggattactacttcattcaagatgatggaagcagatttaaggtggccttgccctat
atgccgtatttctacattgcagcgagaaagggttgtgatcgagaagtttcatcttttcta
tccaagaagtttcagggaaaaattgcaaagttagagaatgtgcccaaagaagatctggac
ttgccaaatcacttggtgggcttgaagcggagttacatcaagctgtccttccacactgtg
gaggaccttgtcaaagtgagaaaggagatctctcctgctgtgaagaagaaccgagagcag
gaccatgctagtgatgagtatacaacaatgctctccagtattctgcaaggtggcagtgta
attactgatgaggacgaaacctctaagaagatagctgaccaattggacaacatagtggac
atgcgagagtatgatgttccctaccacattcgcctctccattgacctcagaatccatgtg
gcccactggtacaatgttagatttcgaggaaatgcttttcctgtggaaatcacccgacga
gatgatcttgttgaacgacctgaccctgtggttttggcatttgacatcgagacgaccaaa
ctgcctctcaaattccctgatgctgagaccgatcagatcatgatgatctcctatatgatt
gatggccagggctacctcatcactaacagggagattgtttcagaagatattgaagatttt
gagttcacccctaagccagaatatgaagggcccttttgtgtcttcaatgaacccgacgag
gtccatctgatccagagatggtttgagcatatccaggaaaccaaacctaccattatggtc
acctacaatggggatttttttgactggccatttgtggaggctagggcagcaattcatggc
ctcagcatgtaccaggagataggcttccagaaggatagccagggggaatataaggcacca
cagtgcatccacatggactgcctcaggtgggtgaagagggacagttaccttcctgtgggc
agtcataatctcaaggcagctgccaaggccaaacttggctatgaccctgtagagctggac
cctgaggacatgtgtcgtatggccactgaacagccccagactctggccacttactcagtg
tcagatgctgtggctacttactacctgtacatgaaatacgtccaccccttcatattcgcc
ctgtgcaccattattcccatggaacctgatgaggtgctgcggaagggctccgggacactg
tgtgaagccttgctgatggtgcaagctttccatgccaacattatcttccccaataagcaa
gagcaggagttcaacaagctgacagatgatggccacatgctagatgctgagacctacgtc
gggggccacgtggaggcactagagtctggtgtcttcagaagtgatatcccctgccggttt
aggatgaatcctgcagcctttgatttcctgctgcaacgagtcgagaagactatgcgccac
gccattgaagaagaagagaaggtgcctgtggaacaagccaccaactttcaagaggtgtgt
gagcagattaagaccaagctcacctccctaaaagatgttcctaacagaattgaatgtcct
ctaatctaccatctagatgtgggggccatgtatcctaacataattcttaccaaccgccta
cagccttctgccatagtggatgaggccacctgtgctgcctgtgacttcaataagcctgga
gcaagttgtcagaggaagatggcctggcagtggaggggagaattcatgccagccagtcgc
agtgaataccatcggattcagcatcagctggagtcggagaagtttccccctttgtttcca
gaggggccagcacgggcctttcacgagctgtcccgtgaagaacaggctaaatacgagaag
aggaggctggcagattattgccggaaagcctataagaagatccatgtgaccaaggtagaa
gaacgtctaactaccatctgccagcgggaaaactcattttatgtggacacagtgcgggcc
ttcagagacaggcgctatgagttcaaaggactgcacaaggtgtggaagaagaagctctcg
gcagctgtagaggtgggcgatgcatcagaggtgaagcgctgcaagaacatggagatcctt
tacgattcactgcagctggctcacaagtgcatcctgaactccttctacggctatgtcatg
cgcaaaggagctcgctggtattccatggagatggctggtatcgtctgctttacaggagcc
aacatcatcacccaagcaagagaactgattgagcagatcgggaggcctttagaattggac
acggacggaatatggtgcgtcctacccaatagctttcctgaaaattttgtcatcaagaca
accaatgcgaagaaacccaaactgaccatctcctatcctggtgccatgttgaacatcatg
gtcaaggaaggctttaccaaccaccagtaccaggaactaacagagccttcgtctctcacc
tatgtcacccactctgagaatagtatcttttttgaagtcgatggaccataccttgctatg
atccttccagcctccaaggaagaaggcaagaagctgaagaaaagatatgctgtgttcaat
gaagatggttccttggctgaactgaaaggttttgaggtgaaacgccgaggggagttgcag
ctgattaaaatattccagtcctcagtttttgaggccttcctcaagggcagcacactggag
gaagtgtatggctcggtggccaaagtggctgactactggctagatgtgctctatagcaag
gctgctaatatgcccgattctgaattgtttgagctgatttctgagaaccgctccatgtct
cggaagctggaagattacggggagcagaagtctacatccatcagcacagcaaagcgcctg
gctgagttcctgggagaccagatggtcaaagatgctggactgagctgccgctatatcatc
tcccgaaagccagaggggtctcctgtcactgagagggccattccacttgccattttccaa
gcagagcctacagtgaggaaacattttctccggaaatggctaaagagttcatcacttcaa
gactttgatattcggacaattctggactgggactactacatagagaggctggggagtgcc
atccagaaaatcatcaccatccccgcagctctgcagcaggtgaagaacccagttccacgt
gtcaaacatccagactggctacacaaaaaactactagagaagaatgatatctacaaacag
aagaagatcagtgagctctttgtgcttgaaggaaagagacagattgtgatggcccaggct
tcagaaaacagtctgagtctctgcactccagacatggaggacattggactcacaaagcca
caccactctacagtcccagttgctactaagaggaagcgagtctgggagacccaaaaggag
tctcaggatattgcactaactgtgccctggcaagaggtcttagggcagcctccctccctt
ggaaccacacaggaagagtggttggtctggctccagttccacaagaaaaagtggcagctg
caggcccaacagcgcctagccctcaggaagaagcaacgcttagagtcagcagaagatatg
ccaaggcttgggcctatccgagaggggccttccacaggactggggagctttttgcgaagg
actgcccgcagcatcatggaccttccatggcagataatacagatcagtgagaccagacag
gctggtctgttccggctgtgggctatcattggcaatgacttgcactgcatcaagctgagt
atccctcgagtattctatgtaaaccagcgggttgccaaagcagaggatggacctgcatat
cggaaggtgaatcgggctcttcctcgttccaacattgtctacaatctctatgagtattca
gtaccagaggacatgtaccaagaacacatcaacgagatcaacactgagttgtcagtacca
gacattgagggcgtgtatgagacacaggtcccattgttattccgggccctcgtgcagctg
ggctgtgtgtgtgtggtcaacaagcagctgacaaggcacctttcgggctgggaagctgaa
acttttgccctcgagcaccttgaaatgcgttctctggcccagttcagctacttggaacca
gggagtatccgccatatctacctgtaccatcacactcagggccacaaggcactctttggg
gtctttatcccctcacagcgaagagcatctgtgtttgtgttggatactgtacgaagcaac
caaatgccagggctcagtgccctgtactcatcagaacacagcctgctgctggacaaggtg
gaccccaagctcctgcctcccccaaaacacacctttgaagttcgtgctgaaaccaacctg
aagactatctgcagagccatccagcgcttcctgcttgcctacaaggaagagcgccgaggg
cccacactcatcgctgtccagtctagctgggagctgtgtaggctgaccagtgagattcca
gtcttagaagagttcccactagtgcctatccgagtggctgacaagatcagctatgcagtc
ctggactggcagcgccatggagctcgccgaatgatccggcactacctcaatttagacttg
tgcctgtcgcaggcctttgagatgagcaggtacttccacatccctgttggaaacctgccg
gaagacatctccacctttggctcagacctcttttttgcacgccacctccagcaccataac
cacctgctttggctatcccctacctctcggcctgacctgggtgggaaggaagctgatgac
aaccgccttgtcatggagtttgatgaccgagccactgtggagatcaatagttctggctgt
tactctactgtgtgcgtggaactggacattcaaaatctggcagtcaacaccatcctccag
tcccatcatgtcaatgacatggagggggctggcagcatgggcatcagcttcgatgtgatc
cagcaggcctccctagaggacatggtaacaggcaatcaagctgccagtgccctggccaac
tacgatgagacagccctctgctctagtaccttcaggatcctgaagagcatggtggttggc
tgggtaaaggaaatcacacagtaccacaacatctatgctgacaaccaggtaatgcacttc
taccgctggctccagtcaccgtgctctctgctccacgacccagcccttcaccggacgctg
cacaacatgatgaagaagctcttcctgcagctcattgctgagttcaagcgcctggggtca
tcagtcgtctatgccaacttcaatcgcatcattctctgtacaaagaagcgccgaatagag
gatgcccttgcctatgtggaatatattaccaacagcatccattctaaagagatcttccat
tccctgaccatctctttctctcgatgctgggaattccttctctggatggatccatccaac
tatggtggaatcaaaggaaaagttccatctagtattcactgtggacaggtaaaagagcaa
gactcccaggcaagagaggaaactgatgaagaggaggaggacaaggaaaaggacgaggag
gaagagggcatgggagagtccgaggttgaggacttactggagaacaactggaacattcta
cagttcttgccccaggcagcctcttgccagagctacttcctcatgattgtttcagcatac
atcgtagctgtgtaccaaagcatgaaggaggagttgagacacagtgccccgggcagtacc
cctgtgaagaggaagggggccagccagttctcccaggagtctgaaggggcaactggatct
cttcctggaatgatcactttctctcaagattatgtggcaaatgagctcactcagagcttc
ttcaccattactcagaaaattcagaagaaagtcacaggttctcggaacaccactgagccc
tcagagatgttccccgtcctccctggttcacacttgctgctcaataatcctgctctggag
ttcatcaaatatgtgtgcaaggtactatctctggatacaaacatcacaaatcaggtgaat
aagctgaacagagaccttcttcgcctggtagacgttggtgaattctctgaggaggcccag
ttcagagacccctgccactcctacgtgctccctgaggtaatctgccacagctgtaatttc
tgccgagacctggacctgtgcaaagattcctctttctctcaggatggagccatcctgcct
cagtggctctgctccaattgtcaagccccctatgactcctctgccattgagtcagccttg
gtggaagccctgcagaggaaactgatggccttcacacttcaggacctggtatgcctcaag
tgccgtggtatgaaagagacccatatgcctgtgtactgcagctgcgcaggggactttact
ctcaccatccgcactgaggtcttcatggaacagattagaatcttccagaacattgccaag
tactacagcatgtcatatctccaggagaccatagaatggctgttacagacaagccctgta
tcaaactgttag

KEGG   Mus musculus (mouse): 18974
Entry
18974             CDS       T01002                                 

Gene name
Pole2
Definition
(RefSeq) polymerase (DNA directed), epsilon 2 (p59 subunit)
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    18974 (Pole2)
   03410 Base excision repair
    18974 (Pole2)
   03420 Nucleotide excision repair
    18974 (Pole2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    18974 (Pole2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18974 (Pole2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     18974 (Pole2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    18974 (Pole2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      18974 (Pole2)
SSDB
Motif
Pfam: DNA_pol_E_B Dpoe2NT
Other DBs
NCBI-GeneID: 18974
NCBI-ProteinID: NP_035263
MGI: 1197514
Ensembl: ENSMUSG00000020974
UniProt: O54956
Position
12; 12 C2
AA seq 527 aa
MAPERLRSRTVSAFKLRGLLLRSEATKYLTEALQSVTELELEENLGKIIDAVEKQPLSSN
MIERSVVEAAVQECSQSMDETIEHVFNIIGAFDIPRFIYNSERKKFLPLSMTNHAAPTLF
GTARDKAELYLERYTILHQRTHRHELFTPPVIGSHLEESGSKFQLKTIETLLGSTSKVGD
VIVLGMITQLKEGKFFLEDPTGTVQLDLSKAQFHSGLYTEACFVLAEGWFEDQVFHANAF
GFPPTEPSSTTRAYYGNINFFGGPSNASVKTYTKLRQLEDENKDAMFVIVSDVWLDQVQV
LEKFHVMFSGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKSLADIICEYPSIHQSSR
FVFVPGPEDPGFGSILPRPPLAESITQEFRQRVPFSVFTTNPCRIQYCTQEIIIFREDLV
NKMCRNCVRFPSSSLDIPTHFVKTILSQGHLAPLPLYVCPVHWAYDYTLRVYPVPDLLVI
ADKYDPFTVTNTDCLCINPGSFPRSGFAFKVFYPSSKTVEDSKLQGF
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcgccggagcggctgcggagccgcacggtctcagctttcaagctgcggggcttgctg
ctcaggagtgaagccaccaagtatctgactgaagctctccagtctgtcactgaattggag
ctagaggagaacctaggaaagatcatcgatgcagttgaaaagcagcccttgtcctcgaac
atgatcgaacgatctgtcgtggaggcagctgtgcaagagtgcagtcagtctatggatgag
actatagagcacgttttcaatatcattggagcttttgatattccacgttttatatataat
tcagaaaggaaaaaatttcttcctctatccatgactaatcatgctgcaccaaccttattt
ggaacagcaagagacaaagccgagctgtatcttgaacgctataccattttacaccagagg
acacacagacatgaattgttcactcctccggtgataggctcacaccttgaagaaagtggg
agcaagttccagcttaaaactatagaaaccttactgggtagcacaagcaaagttggtgac
gtgatcgtcctggggatgataacccagctgaaagaggggaagtttttcctggaagatcct
actggaacagtacaactggaccttagtaaagctcagttccacagtggcttatacaccgag
gcctgcttcgtcctggcagaaggttggtttgaagatcaagtgtttcacgccaatgccttt
ggatttcctcccactgagccctccagcaccacaagggcgtactatggaaatattaatttt
tttggagggccttctaatgcatcagtgaagacgtatacaaagctgagacagctggaagat
gagaacaaggacgccatgtttgtgattgtgtctgatgtttggttggaccaagtgcaagtg
ttggagaagtttcatgtaatgttttctggttactcgccagcacctccaacctgctttatt
ctgtgtggtaatttttcatctgcaccatatggaaaaaatcaagtccaggctttgaaagat
tccctaaaatctttggcagacataatttgtgaatatccaagtatccaccaaagtagccgt
tttgtgtttgtgcctggcccagaggatcctggatttggttccattttaccaaggccgcca
ctcgctgaaagcatcacacaggaattcagacaaagggttccgttttcagttttcacgact
aatccttgcagaattcagtattgtacacaagaaataattatcttccgtgaagacttagtg
aataaaatgtgtagaaactgtgtccgttttcctagcagcagtttggatattcctactcac
ttcgtaaagaccatcttatctcagggacatctggctcctctccctctttacgtatgcccc
gtccactgggcatatgattacacgttgagagtgtacccggtgcccgacctgctggtcatt
gcagacaagtacgacccgttcaccgtgaccaacaccgattgcctctgcataaaccctggc
tcctttccaagaagtggatttgcattcaaagttttttacccttccagtaaaacagtagaa
gacagcaaacttcagggcttttga

KEGG   Mus musculus (mouse): 59001
Entry
59001             CDS       T01002                                 

Gene name
Pole3, 1810034K18Rik, YBL, YBL1
Definition
(RefSeq) polymerase (DNA directed), epsilon 3 (p17 subunit)
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    59001 (Pole3)
   03410 Base excision repair
    59001 (Pole3)
   03420 Nucleotide excision repair
    59001 (Pole3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    59001 (Pole3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    59001 (Pole3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    59001 (Pole3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     59001 (Pole3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    59001 (Pole3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    59001 (Pole3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      59001 (Pole3)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP BUD22 SpoU_methylase RNA_pol_3_Rpc31 Myc_N TAF DUF4746 DDHD Astro_capsid_p Pox_Ag35 CDC45 FYDLN_acid NOA36 Serinc
Other DBs
NCBI-GeneID: 59001
NCBI-ProteinID: NP_067473
MGI: 1933378
Ensembl: ENSMUSG00000028394
Vega: OTTMUSG00000009021
UniProt: Q9JKP7 A0A0R4J091
Position
4; 4 B3
AA seq 145 aa
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFITPLKEALEAYRREQKGKKEASEQKKKDKDKKDSEEQDK
SREEEEEDEERLDEDDQNEEEEIDN
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcggagaggcccgaggacctaaatctgcccaacgccgtcatcaccaggatcatcaag
gaggcgctcccggacggtgtcaacatctccaaggaggcccgaagcgccatctcccgcgcc
gccagtgtcttcgttttgtatgccacatcctgtgccaataacttcgcaatgaaaggaaag
cgcaagactctcaatgccagtgacgtgctgtcagccatggaagagatggaattccagcga
ttcataacaccattgaaagaagctctagaagcgtacaggcgggagcagaaaggcaagaag
gaggcttcggagcaaaagaagaaggacaaagacaaaaaggattccgaagagcaagacaaa
agcagagaggaggaggaggaggatgaagagagactggacgaggacgaccagaacgaagag
gaggaaatagacaactga

KEGG   Mus musculus (mouse): 66979
Entry
66979             CDS       T01002                                 

Gene name
Pole4, 2400007P05Rik, 5830430F06Rik
Definition
(RefSeq) polymerase (DNA-directed), epsilon 4 (p12 subunit)
  KO
K03506  DNA polymerase epsilon subunit 4 [EC:2.7.7.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03410  Base excision repair
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    66979 (Pole4)
   03410 Base excision repair
    66979 (Pole4)
   03420 Nucleotide excision repair
    66979 (Pole4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    66979 (Pole4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66979 (Pole4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     66979 (Pole4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    66979 (Pole4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      66979 (Pole4)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TAF CENP-T_C
Other DBs
NCBI-GeneID: 66979
NCBI-ProteinID: NP_080158
MGI: 1914229
Ensembl: ENSMUSG00000030042
Vega: OTTMUSG00000023086
UniProt: Q9CQ36
Position
6; 6 C3
AA seq 118 aa
MAAAAAAGSGTPREEEAPGGEAAASQAQAPTSAPGGVRLSRLPLARVKALVKADPDVTLA
GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcggcagcggcggctgctgggagcgggacgcccagagaggaagaggctcccggaggg
gaggcagcggcttcgcaggcccaagccccgacgagtgcacccgggggagttcgcctctcg
aggctgcctctggcgagagtaaaggccttggtgaaggcagaccctgacgtaacgctggcg
ggacaggaagccatctttatcctggcgcgtgccgcggaactgttcgtggagactatcgca
aaagatgcctactgctgtgctcaacaaggaaagaggaaaactctccagaggagagatttg
gataatgcaatagaagctgtggatgaattcgcttttctagaaggcactttggattaa

DBGET integrated database retrieval system