KEGG   Mus musculus (mouse): 19012
Entry
19012             CDS       T01002                                 

Gene name
Plpp1, Hic53, Hpic, Hpic53, L, LP, LPP-1, LPP1, P, PAP-2a, PAP2-alpha, PAP2a, Ppap2a, m, mPAP
Definition
(RefSeq) phospholipid phosphatase 1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04072  Phospholipase D signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04975  Fat digestion and absorption
mmu05231  Choline metabolism in cancer
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    19012 (Plpp1)
   00564 Glycerophospholipid metabolism
    19012 (Plpp1)
   00565 Ether lipid metabolism
    19012 (Plpp1)
   00600 Sphingolipid metabolism
    19012 (Plpp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    19012 (Plpp1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    19012 (Plpp1)
  09154 Digestive system
   04975 Fat digestion and absorption
    19012 (Plpp1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    19012 (Plpp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     19012 (Plpp1)
SSDB
Motif
Pfam: PAP2 PAP2_C
Other DBs
NCBI-GeneID: 19012
NCBI-ProteinID: NP_032929
MGI: 108412
Ensembl: ENSMUSG00000021759
UniProt: Q61469
Position
13; 13 D2.2
AA seq 283 aa
MFDKTRLPYVALDVICVLLAGLPFAILTSRHTPFQRGIFCNDDSIKYPYKEDTIPYALLG
GIVIPFCIIVMSIGESLSVYFNVLHSNSFVGNPYIATIYKAVGAFLFGVSASQSLTDIAK
YTIGSLRPHFLAICNPDWSKINCSDGYIEDYICQGNEEKVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPMLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMAI
LVALYVSDFFKDTHSYKERKEEDPHTTLHETASSRNYSTNHEP
NT seq 852 nt   +upstreamnt  +downstreamnt
atgttcgacaagacgcggctgccgtacgtggccctcgatgtgatttgcgtgttgctggct
ggattgccttttgcaattcttacttcaaggcatacccccttccagcgaggaatattctgt
aatgatgactccatcaagtacccttacaaggaagacaccataccttatgccttattaggt
ggaatagtcattccattctgtattatcgttatgagtattggagaatctctgtctgtttac
tttaatgtcttgcattcgaattcctttgtcggcaatccctacatagccaccatttacaaa
gccgtcggagcctttttgttcggagtctcagctagtcagtccttgactgacatcgctaag
tatactataggcagtttgcggccgcacttcttggctatctgtaacccagactggtcaaaa
atcaactgcagtgatggctatattgaggactacatatgtcaagggaatgaagagaaagtc
aaggagggcaggttgtctttctactcgggacactcttcattctctatgtactgcatgctg
tttgtcgcactttatcttcaagccaggatgaagggagactgggcaagactcttacgaccc
atgctccagtttgggctcattgctttttccatatatgtgggcctttctcgagtgtctgac
tacaaacaccactggagtgacgtcacagttggactcattcagggagctgctatggctata
ctggttgctttgtatgtatccgatttcttcaaggacacacattcttacaaagagagaaag
gaagaggatccacacacgactctccatgaaaccgccagttcacggaactactcaaccaat
cacgagccctga

KEGG   Mus musculus (mouse): 50784
Entry
50784             CDS       T01002                                 

Gene name
Plpp2, L, Lpp2, PAP2-G, PAP2-gamma, PAP2c, Pp, Ppap2c
Definition
(RefSeq) phospholipid phosphatase 2
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04072  Phospholipase D signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04975  Fat digestion and absorption
mmu05231  Choline metabolism in cancer
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    50784 (Plpp2)
   00564 Glycerophospholipid metabolism
    50784 (Plpp2)
   00565 Ether lipid metabolism
    50784 (Plpp2)
   00600 Sphingolipid metabolism
    50784 (Plpp2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    50784 (Plpp2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    50784 (Plpp2)
  09154 Digestive system
   04975 Fat digestion and absorption
    50784 (Plpp2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    50784 (Plpp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     50784 (Plpp2)
SSDB
Motif
Pfam: PAP2 PAP2_C LrgB UbiA DUF2976
Other DBs
NCBI-GeneID: 50784
NCBI-ProteinID: NP_056632
MGI: 1354945
Ensembl: ENSMUSG00000052151
Vega: OTTMUSG00000035138
UniProt: Q9DAX2
Position
10 C1; 10 39.72 cM
AA seq 276 aa
MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV
IITATVILVSLGEAYLVYTDRLYSRSNFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMI
GRLRPSFLAVCDPDWSQVNCSGYVQLEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLAL
YVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDHKHHWSDVLVGLLQGALVACLTVR
YVSDFFKSRPPQPCQEDEVPERKPSLSLTLTLGDRP
NT seq 831 nt   +upstreamnt  +downstreamnt
atggagcggaggtgggtcttcgtgctgctggacgtgctgtgcgtgttggtcgcctctctg
cctttcatcatcctgaccctggtgaatgcaccatataagcgggggttctactgtggagat
gactccatccggtacccataccgtccagacacgatcacccacggactcatggctggggtc
atcatcacagctactgtcatccttgtctcattgggagaagcctacctggtgtacacagac
cgtctttattcgcgatccaacttcaacaactatgtagctgccatctacaaggtgctggga
acctttctgttcggggctgctgtgagccagtctctcaccgacctggccaagtacatgatt
ggccgtcttcgacccagtttcttggctgtctgtgaccctgactggagccaggtcaactgt
tctggctatgtgcagctggaggtgtgcaggggcagccctgctaatgtcacggaggccagg
ctgtccttctactctggccactcctcctttggcatgtattgcatgttgttcctggcgcta
tatgtgcaggcccggctctgctggaagtgggcacggctgctgaggcccactgttcagttc
ttcttggtggcctttgcaatctatgtgggctatacccgagtgtctgaccacaagcaccac
tggagtgatgtccttgtcggcctcctgcagggagccctggtggcctgcctcacggtccgc
tatgtttcagatttcttcaaatcccggccaccccagccctgccaggaggatgaagtgccg
gagcgcaagcccagtctgtcactgacgctgacccttggtgaccgaccctag

KEGG   Mus musculus (mouse): 67916
Entry
67916             CDS       T01002                                 

Gene name
Plpp3, 1110003O22Rik, 2610002D05Rik, AV025606, D4Bwg0538e, D4Bwg1535e, L, Lpp3, PRG, PRG-2, Pp, Ppab2b, Ppap2b
Definition
(RefSeq) phospholipid phosphatase 3
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04072  Phospholipase D signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04975  Fat digestion and absorption
mmu05231  Choline metabolism in cancer
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    67916 (Plpp3)
   00564 Glycerophospholipid metabolism
    67916 (Plpp3)
   00565 Ether lipid metabolism
    67916 (Plpp3)
   00600 Sphingolipid metabolism
    67916 (Plpp3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    67916 (Plpp3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    67916 (Plpp3)
  09154 Digestive system
   04975 Fat digestion and absorption
    67916 (Plpp3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    67916 (Plpp3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     67916 (Plpp3)
SSDB
Motif
Pfam: PAP2 PAP2_C PAP2_3
Other DBs
NCBI-GeneID: 67916
NCBI-ProteinID: NP_542122
MGI: 1915166
Ensembl: ENSMUSG00000028517
Vega: OTTMUSG00000008128
UniProt: Q99JY8
Position
4 C6; 4 49.18 cM
AA seq 312 aa
MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIK
PYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQ
NPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNY
RCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAF
YTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPV
DIIDRNNHHNMV
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcaaagctacaagtacgacaaggcgatcgtccctgagagtaagaacggcggcagcccg
gcgctcaacaacaacccgaggaagggcggcagcaagcgggtgctgctcatctgcctggac
ctcttctgcctcttcatggcggctctgcccttcctcatcatcgagacaagcaccattaag
ccttaccgtcgagggttttactgcaatgacgagagcatcaagtatcccctgaaagtcagt
gagactataaacgatgctgtgctctgtgcggtggggatcgtcatcgccatcctggcgatc
attacaggggaattctaccggatctattacctcaaggagaagtcccgctccaccactcag
aacccgtatgtggcagctctctataagcaagtgggatgcttccttttcggctgtgccatt
agccagtccttcaccgacatcgccaaagtgtccatcgggcgcctgaggcctcacttcctg
agcgtctgtgaccctgatttcagtcagatcaattgctccgagggctacattcagaactac
aggtgcagaggagaagacagcaaagtacaggaggccaggaagtccttcttctcgggccac
gcctccttctccatgttcactatgctgtatctggtgctctaccttcaggcccgcttcacc
tggcgcggggcccgactgctccgccccctcctgcagttcactttgctcatgatggccttc
tacacgggattgtcacgggtatctgactacaagcatcatcctagcgatgtcctggcagga
tttgcccaaggagctctggtggcctgctgcatagtgttcttcgtgtccgacctcttcaag
actaagacgagcctctcactgcccgcccctgcgatcaggagggagatcctgtctcccgtg
gacatcatcgacaggaacaatcaccataacatggtgtag

DBGET integrated database retrieval system