KEGG   Mus musculus (mouse): 19166
Entry
19166             CDS       T01002                                 

Gene name
Psma2, Lmp, Lmpc3
Definition
(RefSeq) proteasome subunit alpha 2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19166 (Psma2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19166 (Psma2)
   05012 Parkinson disease
    19166 (Psma2)
   05014 Amyotrophic lateral sclerosis
    19166 (Psma2)
   05016 Huntington disease
    19166 (Psma2)
   05017 Spinocerebellar ataxia
    19166 (Psma2)
   05020 Prion disease
    19166 (Psma2)
   05022 Pathways of neurodegeneration - multiple diseases
    19166 (Psma2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19166 (Psma2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19166 (Psma2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19166 (Psma2)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19166 (Psma2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    19166 (Psma2)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 19166
NCBI-ProteinID: NP_032970
MGI: 104885
Ensembl: ENSMUSG00000015671
UniProt: P49722
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
13; 13 A1
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcagagcgcggttacagcttctcgctgactacattcagcccatctggtaagcttgtc
cagattgaatatgccttggctgcggtagctggaggggccccgtcagtggggattaaagct
gcaaatggcgtagtattagcaaccgagaaaaagcagaaatccatcctgtatgatgaaagg
agtgttcacaaggtggagcccattaccaagcacatcggtttggtgtacagtggcatgggc
cccgattacagagtacttgtacacagagctcggaaacttgctcagcaatactaccttgtt
taccaagaacccattcccacagcccagctggtacagagagtagcctctgtgatgcaggag
tacacgcagtcaggtggtgttcgtccatttggtgtttctttactcatttgtgggtggaat
gagggacgaccatatttatttcagtcagatccatctggagcttactttgcctggaaggcc
acagcaatgggaaagaactatgtgaacgggaaaactttccttgagaaaagatataatgaa
gacctagaactggaggatgccattcatacagccatcttaaccctaaaggaaagctttgaa
gggcagatgacagaagataacatagaagttgggatctgcaatgaggctggctttaggagg
ctcactccaactgaagtgagggattacctggctgccatagcgtga

DBGET integrated database retrieval system