KEGG   Mus musculus (mouse): 19182
Entry
19182             CDS       T01002                                 

Gene name
Psmc3, TBP-, TBP-1
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, ATPase 3
  KO
K03065  26S proteasome regulatory subunit T5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19182 (Psmc3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19182 (Psmc3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19182 (Psmc3)
   05012 Parkinson disease
    19182 (Psmc3)
   05014 Amyotrophic lateral sclerosis
    19182 (Psmc3)
   05016 Huntington disease
    19182 (Psmc3)
   05017 Spinocerebellar ataxia
    19182 (Psmc3)
   05020 Prion disease
    19182 (Psmc3)
   05022 Pathways of neurodegeneration - multiple diseases
    19182 (Psmc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19182 (Psmc3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     19182 (Psmc3)
SSDB
Motif
Pfam: AAA Prot_ATP_ID_OB AAA_lid_3 AAA_5 AAA_16 RuvB_N AAA_2 AAA_22 AAA_33 DUF815 Mg_chelatase PhoH AAA_11 IstB_IS21 Sigma54_activat DUF5827 ATPase AAA_24 DUF3713 AAA_7 RNA_helicase
Other DBs
NCBI-GeneID: 19182
NCBI-ProteinID: NP_032974
MGI: 1098754
Ensembl: ENSMUSG00000002102
Vega: OTTMUSG00000014341
UniProt: O88685 Q3TKG4
Position
2 E1; 2 50.44 cM
AA seq 442 aa
MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKS
EVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQR
KGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEV
DERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLA
RACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFD
SEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMP
NEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTH
EDYMEGILEVQAKKKANLQYYA
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcaggaaatgaatctgctgccgacgcccgagagtccagtgactcggcaggagaagatg
gcgaccgtgtgggatgaagctgagcaagatggcattggggaggaggtgctcaagatgtcc
acggaagagattgtccagcgcacacggctgttagacagcgagatcaagatcatgaagagt
gaagtattgcgagtcacccatgaactccaagccatgaaagacaaaatcaaagagaacagt
gagaaaatcaaagtgaacaaaaccctgccgtaccttgtctccaatgtcatcgagttgctg
gacgttgaccccaatgaccaggaggaggatggtgccaacattgacctggactctcagagg
aagggcaagtgtgcggtgatcaaaacttctacccgacagacatacttcctgccagtgatt
gggttggtggatgcagaaaagctgaagccaggagacctggtgggtgtgaacaaagactcc
tatctgatcctggagaccctgcccactgaatatgactctcgggtgaaggccatggaggtg
gacgagcggcccacggagcaatacagtgacatcgggggcctggacaagcagatccaggag
ctggtggaagccattgtcttgcctatgaaccacaaagagaagtttgagaacttgggtatc
cagcccccaaaaggagtgctgatgtatgggccgcctggaacagggaagactctgcttgcc
cgagcctgtgctgctcagaccaaggccaccttcttgaagctggcaggccctcagctggta
cagatgtttattggagatggcgccaagctggtccgtgatgcttttgccctggccaaggag
aaggcaccatctattattttcatagacgaattggatgccattggtaccaaacgcttcgac
agtgaaaaggcaggagaccgagaggtgcagaggaccatgctggagctactgaaccagctg
gacggctttcagcccaacactcaagtgaaggtaattgcagccactaacagggtggacatc
ctggatccagccctgctgcgctcaggccgcctagaccgcaagattgagtttccaatgccc
aacgaggaggccagagccagaatcatgcagatccactcacggaagatgaatgtcagtcct
gatgtgaactatgaagagctggctcggtgcactgatgacttcaatggagcccagtgcaag
gccgtgtgtgtggaggcgggtatgatcgcattgcgcaggggagccacggaactcactcat
gaggactacatggagggcatcctggaggttcaggccaagaagaaagccaacctacaatac
tatgcctag

DBGET integrated database retrieval system