KEGG   Mus musculus (mouse): 19185
Entry
19185             CDS       T01002                                 

Gene name
Psmd4, Af, Af1, Mcb1, ang, angiocidin
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
  KO
K03029  26S proteasome regulatory subunit N10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19185 (Psmd4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19185 (Psmd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19185 (Psmd4)
   05012 Parkinson disease
    19185 (Psmd4)
   05014 Amyotrophic lateral sclerosis
    19185 (Psmd4)
   05016 Huntington disease
    19185 (Psmd4)
   05017 Spinocerebellar ataxia
    19185 (Psmd4)
   05020 Prion disease
    19185 (Psmd4)
   05022 Pathways of neurodegeneration - multiple diseases
    19185 (Psmd4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19185 (Psmd4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     19185 (Psmd4)
SSDB
Motif
Pfam: VWA_2 UIM VWA Ssl1 RAP80_UIM
Other DBs
NCBI-GeneID: 19185
NCBI-ProteinID: NP_032977
MGI: 1201670
Ensembl: ENSMUSG00000005625
Vega: OTTMUSG00000019658
UniProt: O35226
Position
3 F2.1; 3 40.74 cM
AA seq 376 aa
MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
ASAAEAGIATPGTEDSDDALLKMTINQQEFGRPGLPDLSSMTEEEQIAYAMQMSLQGTEF
SQESADMDASSAMDTSDPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALAS
QATKDGKNDKKEEEKK
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggtgttggagagcactatggtttgtgtggacaacagtgagtacatgcggaacggagac
ttccttcccacccggctgcaggcccagcaggatgccgtcaacattgtatgtcactcaaag
acccgaagcaaccctgagaataacgtgggcctgatcacactggccaatgactgtgaggtg
ctgaccacactcaccccggacactggccgtatcctctccaagctccacactgtccaaccc
aaaggcaagatcaccttctgcactggcatccgcgtggcccacttggctctgaagcaccgg
cagggcaagaatcacaagatgcgcatcatcgcctttgtcggtagccctgtggaggacaac
gagaaggatctggtgaaactagctaaacgccttaagaaagaaaaagtgaatgttgacatc
attaattttggggaagaggaggtgaacacagagaagctgacagcctttgtgaacacactg
aatggcaaggatggaactgggtcccatctagtgacagtgcctcctggacctagcttggct
gatgctctcatcagttctcctattctggctggtgaaggcggtgccatgctgggtcttggt
gccagtgactttgagtttggagtagatcccagtgctgatcctgaattggccctggccctt
cgagtctctatggaagagcagcggcagcggcaggaggaagaggcacggcgggccgctgcg
gcctctgcagctgaggctggaattgctacacctgggactgaagactcggatgacgcccta
ctgaagatgaccatcaaccagcaggagtttggccgtcctgggcttccagacctaagcagc
atgactgaggaagagcagatcgcctacgccatgcagatgtccctgcagggaacagagttt
agccaagaatcggctgacatggatgccagctcagccatggacacatctgatccagtcaag
gaggaggatgactatgacgtcatgcaggacccggagttccttcagagcgtcctagagaac
cttccaggtgtggatcccaacaatgcagccattcgaagtgtcatgggggctctggcctcc
caggccaccaaggatggcaagaatgacaagaaagaggaagagaagaagtga

DBGET integrated database retrieval system