KEGG   Mus musculus (mouse): 19358
Entry
19358             CDS       T01002                                 

Gene name
Rad23a, 2310040P19Rik, AL024030, HR23A, mHR23A
Definition
(RefSeq) RAD23 homolog A, nucleotide excision repair protein
  KO
K10839  UV excision repair protein RAD23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19358 (Rad23a)
  09124 Replication and repair
   03420 Nucleotide excision repair
    19358 (Rad23a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19358 (Rad23a)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19358 (Rad23a)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    19358 (Rad23a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      19358 (Rad23a)
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD UBA_3 Rad60-SLD_2 Crinkler Ubiquitin_2
Other DBs
NCBI-GeneID: 19358
NCBI-ProteinID: NP_001284535
MGI: 105126
Ensembl: ENSMUSG00000003813
Vega: OTTMUSG00000022270
UniProt: P54726 Q8CAP3 Q3TN85
Position
8; 8 C3
AA seq 363 aa
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IKEYHIDEKNFVVVMVTKAKAGQGIPAPPEASPTAVPEPSTPFPPVLASGMSHPPPTSRE
DKSPSEESTTTTSPESISGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQAPEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNF
DDE
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggccgtcaccatcacccttaaaacgttgcagcagcagaccttcaagatccgcatggaa
cctgacgagacggtaaaggtgctgaaggagaagatagaagctgagaagggtagagatgct
ttccccgtggctggacagaaactcatctatgctggcaagatcttgagtgacgatgttccc
atcaaggaataccatatagatgagaagaactttgtggttgtcatggtgaccaaggccaaa
gctggccagggtatcccggcacccccagaggcctcacccactgctgtcccggagccctcc
acacctttccctccagtcctggcatcaggcatgtctcatcccccacctaccagcagagag
gacaagagcccatcagaggagtcaaccaccacaacatctccagaatccatttctggctct
gttccctcttcaggtagcagcgggcgagaggaagacgcagcttccacattagtgactggc
tctgaatatgagacgatgctgactgagatcatgtccatgggctacgagcgggagcgggtt
gtggccgcattgagggccagctacaacaacccccaccgagctgtggagtacttgctcacg
ggaattccaggaagccctgagcctgaacatggttctgtccaggaaagccaggcgcctgag
cagccggccacagaagcagcaggggagaaccccctggagttcctgcgggaccagcctcag
ttccagaacatgcggcaagtgattcaacagaacccagcgctcctgcctgctctgctccag
cagctgggtcaggaaaaccctcagctcctgcagcaaattagccgtcaccaggagcagttc
atccagatgttgaatgagcctcccggggagctggcggacatctctgatgtagagggggag
gttggtgccataggtgaggaggccccacagatgaactatatccaggtgacaccgcaggag
aaggaggctatagaaaggctgaaggcactgggcttcccagagagcctggtgatccaggcc
tacttcgcgtgtgaaaaaaatgagaatttggctgccaacttcctcctgagtcagaacttt
gatgatgagtga

KEGG   Mus musculus (mouse): 19359
Entry
19359             CDS       T01002                                 

Gene name
Rad23b, 0610007D13Rik, AV001138, HR23B, mHR23, mHR23B, p58
Definition
(RefSeq) RAD23 homolog B, nucleotide excision repair protein
  KO
K10839  UV excision repair protein RAD23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19359 (Rad23b)
  09124 Replication and repair
   03420 Nucleotide excision repair
    19359 (Rad23b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19359 (Rad23b)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19359 (Rad23b)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    19359 (Rad23b)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      19359 (Rad23b)
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Rad60-SLD_2 Crinkler UBA_3 DUF2407 UBA_2 DUF1421
Other DBs
NCBI-GeneID: 19359
NCBI-ProteinID: NP_033037
MGI: 105128
Ensembl: ENSMUSG00000028426
Vega: OTTMUSG00000007227
UniProt: P54728 Q3UQN3
Structure
PDB: 
2F4M 2F4O

Position
4; 4 B3
AA seq 416 aa
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALK
EYKIDEKNFVVVMVTKPKAVTTAVPATTQPSSTPSPTAVSSSPAVAAAQAPAPTPALPPT
STPASTAPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGSQGGGGGGGGGGGGGGGGGIAEAG
SGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgcaggtcaccctgaagacccttcagcagcagaccttcaagatcgacatcgacccggag
gagacggtaaaggcattgaaagagaagattgaatctgaaaaggggaaagatgcctttccg
gtagcaggtcagaagttaatttatgcaggcaaaatcctcagtgatgatactgctctcaaa
gaatataaaattgatgagaaaaactttgtggtggttatggtgacaaaacccaaagcagtg
accacagcagtgccagctacaacccagccatcaagtactcccagccccactgcagtcagt
tcttccccagcagtggctgcggcccaggctccagctcccacccctgctctgcctcccact
tccactcctgcctccactgctccagcctccactacagcctcttctgaacccgcacctgct
ggtgccactcagcctgagaaacctgcagaaaagccagcccagacaccagtgcttactagc
ccagcaccagctgacagtacaccaggagattcttcccggtcaaatctttttgaagatgca
acaagtgcccttgtgacaggtcagtcttatgagaatatggtaactgagatcatgtcaatg
ggctatgaacgagaacaagtaattgcagccctgagagccagcttcaacaaccctgacaga
gctgtggaatatcttctaatgggaatccctggagatagagaaagtcaggctgtggttgac
cctcctcctcaggctgtgagtactggaactcctcagtctccagcagtagctgcagctgca
gcaaccacgacagcaactacaacaaccacttctggaggccacccccttgaatttttacgg
aatcagcctcagtttcaacagatgagacaaattatccagcagaatccttctttgctgcca
gccttgctacagcagataggtcgggagaaccctcagctgctgcagcaaattagccaacac
caggagcattttattcagatgctgaatgaaccagttcaggaagcaggcagtcaaggtgga
ggaggtggtggcggaggaggcggtggcggaggaggcggtggaggaattgcagaagctgga
agtgggcacatgaattacattcaagtaacacctcaggagaaagaagctatagaacggtta
aaggcattaggatttcctgaaggacttgtgattcaagcatattttgcttgtgagaagaat
gagaatctggctgccaactttcttctacagcagaactttgatgaagactga

DBGET integrated database retrieval system