KEGG   Mus musculus (mouse): 20422
Entry
20422             CDS       T01002                                 

Gene name
Sem1, DS, DSS1, Shf, Shfdg, Shfdg1, Shfg, Shfm, Shfm1
Definition
(RefSeq) SEM1, 26S proteasome complex subunit
  KO
K10881  26 proteasome complex subunit DSS1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu03440  Homologous recombination
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    20422 (Sem1)
  09124 Replication and repair
   03440 Homologous recombination
    20422 (Sem1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    20422 (Sem1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    20422 (Sem1)
   05012 Parkinson disease
    20422 (Sem1)
   05014 Amyotrophic lateral sclerosis
    20422 (Sem1)
   05016 Huntington disease
    20422 (Sem1)
   05017 Spinocerebellar ataxia
    20422 (Sem1)
   05020 Prion disease
    20422 (Sem1)
   05022 Pathways of neurodegeneration - multiple diseases
    20422 (Sem1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    20422 (Sem1)
   04131 Membrane trafficking [BR:mmu04131]
    20422 (Sem1)
   03051 Proteasome [BR:mmu03051]
    20422 (Sem1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20422 (Sem1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     20422 (Sem1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    20422 (Sem1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     20422 (Sem1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     20422 (Sem1)
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 20422
NCBI-ProteinID: NP_033195
MGI: 109238
Ensembl: ENSMUSG00000042541
Vega: OTTMUSG00000024492
UniProt: P60897 Q3TV35
Position
6; 6 A1
AA seq 70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtccgaaaagaagcagccggtcgacttgggtctcttggaagaggacgacgagttcgag
gagtttcccgcggaagactgggctggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaagatgacttctctaaccagttacgtgctgagctg
gagaagcacggctacaagatggagacatcatag

DBGET integrated database retrieval system