KEGG   Mus musculus (house mouse): 20614
Entry
20614             CDS       T01002                                 
Symbol
Snap25, Bdr, GENA70, SNAP-25, SUP, sp
Name
(RefSeq) synaptosomal-associated protein 25
  KO
K18211  synaptosomal-associated protein 25
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    20614 (Snap25)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20614 (Snap25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20614 (Snap25)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    20614 (Snap25)
SSDB
Motif
Pfam: SNAP-25 DUF5089 SOAR Exonuc_VII_L Sec20 LXG V-SNARE_C DUF349
Other DBs
NCBI-GeneID: 20614
NCBI-ProteinID: NP_001277985
MGI: 98331
Ensembl: ENSMUSG00000027273
Vega: OTTMUSG00000015556
UniProt: P60879
Position
2:136555359..136624348
AA seq 206 aa
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt   +upstreamnt  +downstreamnt
atggccgaagacgcagacatgcgcaatgagctggaggagatgcagaggagggctgaccag
ctggctgatgagtccctggaaagcacccgtcgcatgctgcagctggttgaagagagtaaa
gatgctggcatcaggactttggttatgttggatgagcaaggcgaacaactcgatcgtgtc
gaagaaggcatgaaccatatcaaccaagacatgaaggaggccgagaaaaatttaaaagat
ttaggcaaatgctgtggccttttcatatgtccttgtaacaagcttaaatccagtgatgct
tacaaaaaagcctggggcaataatcaggatggagtagtggccagccagcctgcccgtgtg
gtggatgaacgggagcagatggccatcagtggtggcttcatccgcagggtaacaaatgat
gcccgggaaaatgagatggatgagaacctggagcaggtgagcggcatcatcggaaacctc
cgccatatggctctagacatgggcaatgagattgacacccagaatcgccagatcgacagg
atcatggagaaggctgattccaacaaaaccagaattgatgaagccaaccaacgtgcaaca
aagatgctgggaagtggttaa

DBGET integrated database retrieval system