KEGG   Mus musculus (mouse): 20869
Entry
20869             CDS       T01002                                 

Gene name
Stk11, AA408040, Lkb, Lkb1, Pa, Par-4, R75140
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04530  Tight junction
mmu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    20869 (Stk11)
   04151 PI3K-Akt signaling pathway
    20869 (Stk11)
   04152 AMPK signaling pathway
    20869 (Stk11)
   04150 mTOR signaling pathway
    20869 (Stk11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    20869 (Stk11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    20869 (Stk11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    20869 (Stk11)
  09149 Aging
   04211 Longevity regulating pathway
    20869 (Stk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20869 (Stk11)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     20869 (Stk11)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   20869 (Stk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal Kdo APH Antimicrobial_6
Other DBs
NCBI-GeneID: 20869
NCBI-ProteinID: NP_035622
MGI: 1341870
Ensembl: ENSMUSG00000003068
Vega: OTTMUSG00000000002
UniProt: Q9WTK7 Q3V4A1
Position
10; 10 C1
AA seq 436 aa
MDVADPEPLGLFSEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPG
NLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCGPPLSDLLRGMLEYEPAKRFSI
RQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEEEDLFDIE
DGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGTANPARK
VCSSNKIRRLSACKQQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggacgtggcggaccccgagccgttgggccttttctccgagggcgagctgatgtcggtg
ggcatggacaccttcatccaccgcatcgactccaccgaggtaatctaccagccgcgccgc
aaacgcgccaagctcatcggcaagtacctgatgggggacctgctcggggagggctcgtac
ggcaaggtgaaggaggtgctggactccgagaccttatgccgcagggcggtcaagatcctc
aagaagaaaaagctgcgcaggatccccaatggagaggccaacgtcaagaaggagatccag
ctgctgcggcggctgcggcatcggaatgtgatccagcttgtggacgtgctgtacaatgag
gagaagcagaagatgtatatggtgatggagtactgcgtatgtggcatgcaggagatgctg
gacagtgtgccggagaagcgcttccctgtgtgccaagctcatgggtacttccgccagctg
attgacggcctggaatacctacacagccagggcattgttcacaaggacatcaagccgggc
aacctgctactcaccaccaatggcacactcaagatctccgacctcggtgttgccgaggcc
ctgcaccctttcgctgtggatgacacctgccggacaagccagggctccccggccttccag
cctcctgagattgccaatggactggacaccttttcaggtttcaaggtggacatctggtca
gctggggtcacactttacaacatcaccacgggcctgtacccatttgagggggacaatatc
tacaagctctttgagaacattgggagaggagacttcaccatcccttgtgactgcggccca
ccactctctgacctactccgagggatgttggagtatgagccggccaagaggttctccatc
cgacagattaggcagcacagctggttccggaagaaacaccctctggctgaggcgctcgta
cctatcccaccaagcccagacactaaggaccgctggcgcagtatgactgtagtgccctac
ctggaggacctgcatggccgtgcggaggaggaggaggaggaagacttgtttgacattgag
gacggcattatctacacccaggacttcacagtgcctggacaggtcctggaagaggaagtg
ggtcagaatggacagagccacagtttgcccaaggctgtttgtgtgaatggcacagagccc
cagctcagcagcaaggtgaagccagaaggccgacctggcaccgccaaccctgcgcgcaag
gtgtgctccagcaacaagatccgccggctctcggcctgcaagcagcagtga

DBGET integrated database retrieval system