KEGG   Mus musculus (house mouse): 208898
Entry
208898            CDS       T01002                                 
Symbol
Unc13c, 1500037O19Rik, D9Ertd414e, Munc13-3, Unc13h3
Name
(RefSeq) unc-13 homolog C
  KO
K15293  protein unc-13 A/B/C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    208898 (Unc13c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    208898 (Unc13c)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    208898 (Unc13c)
SSDB
Motif
Pfam: MUN C2 C1_1
Other DBs
NCBI-GeneID: 208898
NCBI-ProteinID: NP_001074622
MGI: 2149021
Ensembl: ENSMUSG00000062151
Vega: OTTMUSG00000044794
UniProt: Q8K0T7
Position
9:complement(73386704..73915421)
AA seq 2210 aa
MVASLFKSLILAYIHKLCKGMFTKKLGNTTKKKENRQQKKDQDFPTAGHTKPPKLSNALK
STVKKIAKCSSTRNFSIEDEEGHKDFSLSPTFSYRVAIANGLQTAVTNSDEDLLQELSSI
ESSYSESFNELRSSTENQVQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHTLKLGALRK
LRKWKKSQECVSSDSELSTVKKTWGIRSKSLDRTARNPKTNVLEPGFSSSGCISQTHDVM
EMIFKELQGISQIETELSELRGHVNALKYSIDEISSSVEVVQSEIEQLRTGFVQARRETR
DIHDYIKHLGHMGSKVSLRFLNVPEERHEYVESVVYQILIDKMGFSDVPNAIKIEFAQRI
GQQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTYDIRERKEKGVLP
SSQTYESMDMKLSTPEPKAKKNAWLSPNDSDRELESDLSRSSYADSPAKGSSSKSSSKSH
SARSKNKAANSRTSQKSDYNKRPSQPPASSTPEKQTPHYVEATPPLWHSQSDFFTLKLSR
SESDFSKLCQSYSEDFSESQFFCRTNGSSLLSSSDRELWQRKQEGMPALYHRLQDQGLDE
TIPAVPGQAEIENTETVDSGMSNSMVCASGDRSNYSGSQLSLHEDLSPWKEWNQAGQGTD
DVGLDSSTQEPFDYDTNSLSDQQLDLSSKDLDDLGKCHSDLQDDSESYDLTQDDNSSPCP
GLDNEPQGQWVGQYDSYQEANSNDLYPNQSHPSMMYRSQSELQSDDSEGAQPKSWHSRLS
IDLSDKTFKFPKFGSTLQRAKSALEVVWNKSTQSLSGCEDSGSSLMGRFRTLSQSTANES
STTLDSDIYTEPYYYKAEEEEDYCEPVADSETDYVEVMEQVLAKLENRTSITEVNEHIKD
YDHPSYETPYETPQDEGYDGQADDIISEGELETLNEPAVEMELAEDENQNLPAESLEVMK
PKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSMDEKARIVSGNDLDASKFSALQVFGG
AGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHVFRKT
LQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQISKEDFVQYT
KAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLN
PVWDEKFFFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMD
VWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSNGSVK
IPEVKGDEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTHFSCLSSKYMCPGVPAVMSAL
LANINAFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRENFPAS
NSERLQDLKSTVDLLTSITFFRMKVLELQSPPKASAVVKDCVRACLDSTYKYIFDNCHEL
YSQLIDPSKKQDVPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQELNMG
KISAEIMWSLFALDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPE
YSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFAQLNQSF
EIIKKLECPNPEALSHLMRRFAKTINKVLVQYAAIVSNDFSSYCDKETVPCILMNNIQQL
RVQLEKMFESMGGKELDPEASTILKELQIKLNGVLDALSITYGESFQLTIEECIKQMGAE
LNQMRANGNSTANKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLVL
NKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAIVEVVLAT
IKQYFHAGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALIKKFIETQGSQSRSSKDAVG
QISVHVDVTTTPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCMLGPSLGDKKRKQGTK
TKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGS
YGAWYPLLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIEESA
NT seq 6633 nt   +upstreamnt  +downstreamnt
atggtggccagtctctttaagagcttgattttagcttatatacataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaagaaagagaatcgtcagcagaaaaaa
gatcaagattttccaactgctggccacaccaaaccccctaaattgtcaaatgccctgaaa
agcactgtaaaaaagattgcaaagtgctcatctacccggaacttctccatagaagacgaa
gagggtcacaaagacttctccctgtcacccacattcagttaccgagttgctatcgccaat
ggcctgcaaacagccgtgaccaacagcgatgaggatctgctccaggagctgtcttccatc
gagagctcgtactctgaatccttcaatgagctaaggagcagcacggaaaaccaggtccaa
tcaacacacaccatgcctgtccgacgtaacaggaagagctcgagcagtttggcaccttct
gagggcagctcagatggggagcgcaccctccacaccttaaaactgggtgctctacggaaa
ctgaggaaatggaagaagagccaagagtgcgtctcctcagactcggagttgagcaccgtc
aagaaaacctggggcataagaagcaaatcattagatagaactgcccggaacccaaagaca
aatgtcttagagccagggttcagctcctctggctgcattagccaaacccacgatgtcatg
gaaatgatctttaaagagcttcagggtataagtcagatcgaaacagaactttccgaactc
cgagggcacgtgaatgctctcaagtactctatcgatgaaatctccagcagtgtggaggta
gtccagagcgagatcgaacagcttcgaacagggtttgtccaggctcgaagggaaactcga
gacatccacgattacattaaacacttgggtcacatggggagtaaggtaagcctgagattt
ttaaatgtgcctgaagaaagacacgagtacgtggaaagtgtggtgtaccaaattcttata
gataaaatgggtttctcagatgtaccgaatgctattaaaattgaatttgctcagaggata
gggcagcaaagggactgcccaaatgcaaaacctcgacccatcctagtgtactttgaaacc
cctcagcaaagggattctgtcttaaagaaatcgtataagctgaaaggtacaggcatcggg
atctccacagatattctaacttatgatatcagagaacggaaagaaaaaggggtattgcca
tcttcccagacatacgaaagcatggatatgaagttatccacgccagagcccaaagccaag
aagaacgcttggctgtcacccaatgacagtgacagagagctggagtcagacctcagcaga
agcagctatgctgactctccggcaaagggaagttcttctaaatccagctcaaagtcacac
agtgctcggtccaagaacaaagcagctaacagcagaacatcacagaagtcagactacaat
aaacggccctcccaaccgccagcatcaagtaccccagaaaagcaaacacctcactatgtg
gaggccacaccaccactctggcattcacagagtgacttcttcactcttaaacttagtcgc
tccgaatcggatttctccaaattgtgtcaatcttattcagaggatttttctgaaagccag
tttttctgtcgaactaatgggagctccctcctttcctcgtctgaccgggaactttggcag
aggaaacaggagggcatgcctgccttgtaccaccgtcttcaggaccagggtttggatgag
actattccagcagtgccagggcaggctgaaattgagaatacagaaacagtagacagcggt
atgagcaacagcatggtgtgtgcatctggagaccgaagcaattacagcggttctcagctc
tcattgcacgaggacctgtctccatggaaggagtggaatcaagcagggcaaggaactgat
gatgttggcttagattcatctacccaggaaccttttgactacgataccaacagtttgtct
gaccaacagctggatctctctagcaaagacctagatgaccttggcaagtgccacagcgac
ctgcaagatgactctgaaagctatgatttaacccaggatgacaactcctctccatgccct
ggattggataatgaaccacaaggccagtgggttggccagtacgactcttatcaggaagcc
aattctaatgacctgtatcccaaccaaagccatccatccatgatgtatagaagtcaaagc
gaactgcaaagtgatgattcagagggggcccagcccaagtcctggcacagtcggctaagc
attgacctttctgataagacttttaagttccccaaatttggatctactcttcagagagca
aagtcagccctggaagtggtgtggaacaagagcacacagagtctcagtgggtgtgaggac
agcggctcttccttaatggggagatttcggacattatcacaatccaccgcgaacgagtca
agtaccacccttgactctgatatctacacggaaccctattactataaagccgaggaagag
gaggactactgtgaaccagtggctgacagtgagacagattatgttgaagtgatggagcag
gtcctagctaagctagaaaacaggactagtatcactgaagtaaacgaacacattaaagac
tatgaccacccttcctatgaaactccttacgagaccccgcaagatgagggctatgatggg
caggctgatgacatcattagtgaaggagaactggaaaccttaaatgaaccagcagttgaa
atggaattagcagaagatgagaaccaaaacctccctgcagagtcactggaggtcatgaag
ccaaagagaatcaggccttccttcaaagaagcagctttaagggcctataagaagcagatg
gcagagctggaagagaagatcctggctggagatagcagctctatggatgaaaaggctcga
atagtaagtggcaatgatttggatgcttccaaattctccgcactccaggtgttcggtggg
gctgggcgtggactgtatggtattgatagcatgcctgacctccgcaggaaaaagacattg
cctattgtgcgggatgtggccatgaccctggctgcccggaaatctggtctctcccttgct
atggttatcaggacatcactgaataatgaggagctgaaaatgcatgtcttcaggaagacc
ttgcaggcattgatctaccccatttcttccaccactccccacaacttcgaggtctggacg
gctaccacacccacctactgctatgaatgtgaagggctcctgtggggcatcgcaaggcaa
ggcatgaagtgtctggagtgtggggtgaaatgccacgagaagtgtcaggacctgctcaac
gccgactgtctgcagcgagcagcagagaagagctctaagcacggtgcggaggacaagacc
cagactatcatcacagccatgaaagaaagaatgaagatcagggagagaaacagaccagag
gtgtttgaagtcattcaggaaatgttccagatctccaaagaggattttgtgcagtacaca
aaggctgccaagcagagcgtgctggatgggacgtcgaagtggtctgcaaaaattaccatt
acagtggtttccgcacaaggcttgcaggcaaaagacaaaacagggtccagcgacccatat
gtgacagttcaagttggcaaaaataaaagaagaacgaaaactatctttggaaacttgaat
ccagtgtgggacgagaagttcttctttgagtgtcataactcgacagatcgaatcaaggtc
agagtatgggatgaagatgatgacattaaatccagagttaagcagcacttcaagaaggag
tcggatgactttctgggacagacgattgtggaagtcaggactctaagtggtgagatggat
gtctggtacaacttagagaaacggacagataagtcagctgtgtctggggccatccgacta
aaaatcaatgtggagataaagggagaagagaaggtcgcaccataccatatacaatacact
tgtttacacgagaacctgttccattacctgacggaagtgaagtctaatggcagtgtaaaa
ataccagaggtcaagggcgatgaagcctggaaggttttctttgatgatgcgtctcaggaa
atagtggatgaatttgccatgcgttatggggttgagtccatttatcaagctatgacgcac
ttttcatgtctgtcttctaagtacatgtgcccgggtgtccctgcagtcatgagcgccctg
ctggcgaacatcaatgccttctatgctcatacaactgtctccactaacgtgcaggtttct
gcctctgatcgctttgctgctacaaactttgggagggaaaaattcataaaactactggac
cagttgcataactccttaaggattgacctgtcaaagtacagggaaaactttccagccagc
aacagtgagagactacaggacctaaagtccactgtggacctgttgaccagcatcaccttc
ttccggatgaaggtcctggagctgcagagccccccaaaggccagtgcagttgtgaaggac
tgtgtcagggcttgtctggattccacatacaagtatatcttcgacaactgccatgaactc
tattctcagctgatagacccgagcaagaagcaggatgtccctcgagaagaccagggacca
accaccaagaacctggacttctggccacagttgattacactgatggtcactattattgat
gaggataaaactgcctacacccctgttctcaatcagtttccacaagaactaaacatgggg
aagataagtgcagaaatcatgtggtctctttttgctctcgatatgaaatatgctctagag
gaacatgagaagcaacgcttatgcaagagcaccgattatatgaatttgcatttcaaagtg
aaatggttttataatgagtatgtacgagaacttcctgccttcaaggatgctgttccagaa
tattccctgtggtttgagccttttgttatgcaatggctagatgaaaatgaagatgtgtcc
atggagttccttcatggagcactgggaagagacaaaaaagatggattccagcagacatcg
gaccacgcccttttctcctgttctgtggttgatgtctttgctcagcttaaccagagcttt
gagatcattaagaaactggaatgccccaatcctgaagccctatcacacttaatgagacga
tttgcaaagaccatcaataaggttctggtccagtacgctgcgatcgtatcaaatgacttc
agttcatactgcgataaggagacagtgccttgcatattgatgaacaacatccaacaactg
cgggtccagctggaaaaaatgtttgaatccatgggtgggaaagagctagaccctgaagct
agcactattctgaaagaacttcaaatcaaactcaacggggttctggatgcactcagcatc
acttatggagaaagtttccaacttacaattgaagagtgtataaagcagatgggtgccgag
ctgaatcagatgcgagccaacgggaacagcacagcgaataagaacagtgcggcgatggat
gcagagattgtgctgaggccgctcatggacttcttggataagacattaagtctttcagca
aaaatttgtgagaaaacggtcctgaagcgagttctgaaggagctctggaaattagtactt
aacaagatagagaagcagattgttctccctccactgacagaccaaacggggcctcagatg
atcttcattgctgctaaagatcttggacagttatccaaactgaaggagcatatgattcga
gaagatgccaagggtctgacaccaagacaatgtgcaatagtggaggtggtcttggccact
ataaagcaatattttcatgcaggaggaaatggcctgaagaagaattttctggagaaaagc
ccagatcttcattccctgagatacgctctcagcctctacacacaaactactgatgctttg
atcaagaagttcatagagacacagggctcacagagtcgttcctccaaagatgctgtaggc
cagatctctgtccatgtggatgtcaccaccaccccagggactggagaccataaagtcact
gtgaaagtaattgcgatcaatgacctaaactggcagaccaccgccatgttccgccccttt
gtggaagtgtgcatgctgggacccagcctaggggacaagaagagaaaacaagggacaaag
acaaaaagcaacacatggtcaccgaagtacaatgaaaccttccagttcattctgggtaac
gagaaccgcccaggagcctatgaacttcacctctcggttaaggactactgctttgcccga
gaagatcgaataattggaatgacagtcattcagttacagaacatagcagagaaagggagc
tacggggcatggtaccctcttctgaaaaatctctctatggatgaaactggtttaaccatc
ctcagaatactctctcagaggaccagcgacgatgtcgctaaagagtttgtgagacttaag
tcagaaacgaggtctattgaagagagtgcctga

KEGG   Mus musculus (house mouse): 22249
Entry
22249             CDS       T01002                                 
Symbol
Unc13b, Munc13-1, Munc13-2, Unc13a, Unc13h1, Unc13h2
Name
(RefSeq) unc-13 homolog B
  KO
K15293  protein unc-13 A/B/C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    22249 (Unc13b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22249 (Unc13b)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    22249 (Unc13b)
SSDB
Motif
Pfam: MUN C2 C1_1
Other DBs
NCBI-GeneID: 22249
NCBI-ProteinID: NP_067443
MGI: 1342278
Ensembl: ENSMUSG00000028456
Vega: OTTMUSG00000006761
UniProt: Q9Z1N9
Position
4:43046193..43264873
AA seq 1602 aa
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKPLPTAAAQCCHWTY
LGWGEHQTFEDPDSAVDDRDSDYRSETSNSAPPPYHTTTQPNASVHQFPVPVRLPQQLFL
QGSSHDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSQGSSLLSELDQYHEQDDDGR
ERDSIHSSHSYGSLSKDGQAGLGEQEKALEVTCESEKEKTGESKEMRDDATIHPPSDLVL
HKDHVLGPQESLPEETASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAG
GLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQAL
IYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADCL
QRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTVK
QSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWE
EKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYN
LEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPEA
RGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANI
NAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQ
DLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQYQ
LQEQPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLSQFPQELNVGKVSAEVMWH
LFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPAWFEQFV
LQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECP
DPNILAHYMRRFAKTIGKVLMQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMFE
AMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGN
ASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVIV
LPPLTDQTGTQLILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAG
GNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGAGVDDPVGEVSIQVDL
FTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWTP
KYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLAVMPLRDVAAKGSCACWCPLG
RKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSTEEGS
NT seq 4809 nt   +upstreamnt  +downstreamnt
atgtcgctgctctgtgtgcgtgttaaaagagccaaattccagggttcaccagataaattt
aacacatatgtgaccctgaaagtccagaacgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggagcaggatttcatgtttgagatcagtcgtctggacctgggccta
agtgtggaggtgtggaacaagggactgatatgggacacaatggtgggcaccgtgtggatt
gcactgaagacaatccgtcagtcggatgaggaagggcccggggagtggtctacactggag
gcagagacgttaatgaaagatgatgagatctgtggaactaaaaatccaactcctcataaa
atcttgcttgatacaagatttgagctgccttttgacatcccagaggaggaagccagatat
tggacctacaaattggagcaaatcaatgccttggcagatgataatgagtattctagtcaa
gaagaaagccagaggaagccattacccactgctgccgcccagtgttgtcactggacctat
ttgggctggggagagcatcagacctttgaagaccctgatagtgccgttgatgaccgagac
agtgactaccgcagtgagaccagcaatagcgccccacctccttaccacacgactacccag
cccaacgcttctgtacaccagttccctgttcctgtgcggctgccacagcagctctttctt
caaggcagttcccatgactcttgcaatgactctatgcagagttacgaccttgattatcca
gagcgtcgggccctcagccctaccagcagtagtaggtatggctcctcctgtaatgtgagt
caaggaagctctctgctgagtgagctggaccagtatcatgagcaagatgatgatggtcgg
gagagggactccattcattctagtcatagctatggcagcctctccaaagatggccaggct
ggtttgggagaacaagagaaagccttggaagtgacatgtgaatcagaaaaagagaaaaca
ggtgaatccaaggagatgagagatgatgctacaatccaccctccttcagatctggtgctg
cataaggaccatgtcctaggaccccaggagagtcttcctgaggagaccgcatcatcgcca
tttacccaggccagagcacactggttccgagcggttaccaaggtccgactccaactgcag
gagatttcagatgatggtgacccctccttgcctcagtggctcccagaagggccagctgga
gggctctatggcattgacagcatgccagatctacgaaggaagaagccactgccacttgtc
agtgatctgtcactggtccagtcacggaaagctgggattacatctgctatggctacacgt
acctctctcaaggatgaagaactgaaatctcatgtgtataagaaaactctgcaggcctta
atctaccccatctcgtgtaccacgccccacaactttgaggtctggtctgccactacacct
acctattgctatgagtgtgaaggcttgctctggggccttgcccggcaaggcatgcgctgc
agcgagtgtggagtcaagtgccatgagaagtgccaggacctgctcaatgctgactgccta
cagcgggctgctgaaaagagctctaagcatggagctgaggaccgaactcagaacattatc
atggccatgaaggaccgtatgaagatccgagaacggaataaaccagagatctttgaggtt
atccgggatgtgttcacagtgagcaaagttgcgcatgtgcagcagatgaaaacagtaaag
cagagtgtcctggatggcacctccaagtggtcagccaaaattaccatcacggtggtttgt
gcccagggcctacaagccaaagacaagacaggatccagtgacccttatgtgactgtgcaa
gttgggaaaaccaagaagcgcaccaagaccatttttggaaatttgaatcctgtttgggaa
gagaagttccattttgagtgccacaactcttctgatcgaattaaggtacgcgtgtgggat
gaggatgatgacatcaagtccagagtaaagcagcggctaaagcgagagtcagatgatttc
cttggccaaactatcattgaagttcgaacgctgagtggagagatggatgtctggtacaat
ctggagaagagaacagacaagtcagctgtctcaggggctatccgacttcaaatcagtgtg
gagatcaagggggaggagaaggtagccccataccatgtacaatatacatgtctccatgag
aaccttttccattacctcacagacattcagggcagtggaggagtctggatcccagaggct
cggggggacgatgcatggaaggtgtactttgatgagacagcccaagaaattgtggatgaa
ttcgctatgcgctatggcatcgagtccatttatcaggccatgacgcactttgcatgtttg
tcatccaagtacatgtgtcctggtgtaccagccgtgatgagcaccttactggccaacatc
aatgcctattatgctcacacaactgcctccactaacgtctctgcatctgatcgttttgca
gcctccaactttggtaaagaaagatttgtaaaactgctggaccagctacacaactcactg
aggatagacctctctacatacaggaataactttcctgctgggagccctgagcggcttcag
gatttaaagtctacagtggatttgctgaccagcattactttcttcaggatgaaggtgcaa
gaacttcagagccctccaagagccagccaggtggtaaaggactgtgtgaaagcctgcttg
aactctacatatgaatacatcttcaacaactgccatgacctctacagtcaccagtatcag
ctgcaggaacaacctctagaggaaccagggcccagcattcggaacttggatttctggccc
aaacttatcacactcattgtttcgatcatagaggaggataagaattcctacacacctgtt
ctgagccagtttcctcaggagttgaacgtaggaaaagtcagtgcagaagtgatgtggcat
ctgtttgctcaagacatgaaatatgcactggaggaacacgagaaagaccggctgtgtaag
agtgctgactacatgaacctgcacttcaaggtgaagtggctccacaatgaatatgtgcgc
gatctgcctgccctccaggggcaagtgcctgagtacccagcgtggtttgagcagtttgtg
ctacagtggctagatgagaatgaagatgtgtcactggaattccttcgtggggccttggaa
cgagataagaaggatgggttccagcagacatcagagcatgccttgttttcctgttctgtg
gtggatgtctttacacaactcaaccagagctttgagatcatccggaagttggaatgtcca
gaccccaacatccttgcccactacatgagaaggtttgctaagaccattgggaaagtgctg
atgcagtatgcagacatcttatcaaagaacttcccagcttactgcacaaaggagagactg
ccctgtatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgtttgag
gccatgggaggcaaagagctggactccgaagctgcagacagtctgaaggagctgcaggtg
aaactgaatacagttctggatgagcttagcatggtgtttggaaacagcttccaggtgcgg
attgatgaatgtgttcgacaaatggctgacatcctgggccaagttcggggcacagggaat
gcatcccctaacgccagggcctcggtggctcaggatgcagatagtgtgctgcgacctctc
atggacttcctggatggcaacctcacgctgtttgccactgtgtgtgagaagacagttctg
aagcgggtcctgaaggagctctggcgggtggtgatgaacaccatggagcgggttattgtc
ctgcccccactcactgaccagacgggcacccagctgatcttaactgctgccaaggagctg
agccagctttccaaactcaaggaccacatggtacgggaggaaacacggaatctcactcca
aagcagtgtgctgtcctcgacttggccttggacaccatcaagcaatacttccatgcagga
ggcaatggtctgaagaaaaccttcctggaaaagagcccagacctgcagtctctgcgttat
gccctctctctgtatacacagactacagacactctcatcaagacatttgtgcgctcacag
actgcccagggggctggtgtggatgaccccgtgggagaagtctctattcaggtggactta
tttacacatcctggcactggggagcataaggtcacagtgaaagtggtagcagccaatgac
ctcaagtggcagacagcgggtatgttccggccttttgtggaagtgaccatggttggccca
caccaaagtgataagaagaggaagttcacaaccaagtctaaaagtaacaactggactccc
aagtacaacgagacgtttcacttcctcctgggaaatgaagagggtccagaggcctatgaa
ttgcagatctgtgtgaaggattactgctttgcccgggaggatcgtgtgataggactggca
gtgatgcccctgagggatgtggcagctaagggcagctgtgcctgctggtgcccactgggc
cggaagatccatatggatgagacaggcatgaccattctccggattctgtctcagaggagc
aatgacgaggtagcccgagagttcgtgaagctcaaatcagagtctcgatccacagaggaa
gggagctga

KEGG   Mus musculus (house mouse): 382018
Entry
382018            CDS       T01002                                 
Symbol
Unc13a, 2410078G03Rik, Munc13-1
Name
(RefSeq) unc-13 homolog A
  KO
K15293  protein unc-13 A/B/C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    382018 (Unc13a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    382018 (Unc13a)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    382018 (Unc13a)
SSDB
Motif
Pfam: MUN C2 C1_1
Other DBs
NCBI-GeneID: 382018
NCBI-ProteinID: NP_001025044
MGI: 3051532
Ensembl: ENSMUSG00000034799
Vega: OTTMUSG00000040153
UniProt: Q4KUS2
Position
8:complement(72079356..72124418)
AA seq 1712 aa
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTKDPTFHR
ILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDQQDKPLPVPSSQCCNWNYF
GWGEQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYSD
SMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSELDDERDRDSY
HSCHSSVSYHKDSPRWDQDDEDLEDLEDLEDEELPEEEEELEEEGEEELEEEDLEEEEEV
PDDLASYTQQEDTTVAEPKEFKRISFPTAAPQKDDKVSAVPTEAPEVAKGIPKAATPEEK
AAAERAQEAEPPKSEESFRSREEEEGQEGQDAMSRAKANWLRAFNKVRMQLQEARGEGDM
SKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTLNNEE
LKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKC
HEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQEIFAV
TKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKR
TKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIE
VRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHFVT
DVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCP
GVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMY
RNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYI
FNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLN
QFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEYVAEL
PTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVD
VFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKV
PCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPH
IEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVL
KRVLKELWKLVMNTMEKTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQMIFN
AAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDL
QSLRYALSLYTQATDLLIKTFVQTQSAQGSGVEDPVGEVSVHVELFTHPGTGEQKVTVKV
VAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFATKSKNNSWAPKYNESFQFSLSADAG
PECYELQVCVKDYCFAREDRTVGLAVLQLRELAQRGSAACWLPLGRRIHMDDTGLTVLRI
LSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5139 nt   +upstreamnt  +downstreamnt
atgtctctgctgtgcgtgggagtcaaaaaagccaagtttgacggtgcccaagagaagttc
aacacatacgtgacgctgaaggtgcagaacgtgaagagcactaccatagctgtacgtggc
agccagcccagctgggagcaggacttcatgtttgagatcaaccgcctggatctaggcctg
accgtggaggtgtggaacaagggtctcatctgggacacgatggtgggtactgtgtggatc
ccgctgcggaccatccgccagtccaatgaggagggcccaggagagtggctcacactggac
tctcaggccatcatggcggacagtgagatctgtgggaccaaggaccccaccttccatcgc
atcctcctggacgctcatttcgagctgccgttggacatccctgaggaggaggcacgctac
tgggccaagaagctggagcagctgaatgccatgcgtgaccaggatgagtactccttccag
gaccagcaggacaagccgctgccagtgcccagcagccagtgctgcaactggaattacttt
ggctggggagaacagaatgacgaccccgacagtgcggtggatgaccgggacagtgactat
aggagtgagaccagcaacagcatcccaccgccctactatacgacttcgcagcccaacgcc
tctgtgcaccagtactccgtgcgaccgccccctctggggtcccgggagtcctacagtgac
tccatgcacagctatgaggagttctctgagccgcgggcgctcagccccacaggcagcagc
cgctatgcttcttccggggagctgagccagggaagctcacagctgagcgaggacttcgac
cctgatgagcacagcctgcagggctcggagctggatgacgagagggaccgcgattcttat
cactcctgtcacagctccgtgagttaccacaaggactcaccccgctgggaccaggacgat
gaggacctggaggacctggaggacctggaagatgaggagctgcccgaggaggaggaggag
ttggaggaggagggggaggaggaattggaggaagaggatttggaggaggaggaggaggtg
cctgatgacctggccagctacacccagcaggaggacaccactgtggctgagcccaaagag
ttcaagcggatcagcttcccaacggctgcgcctcagaaggatgacaaggtttcagctgtg
cctacagaggcccccgaggtggccaaaggcatccccaaagcagccacacccgaggagaag
gcagctgcagagcgtgcgcaggaagccgagccccccaagtctgaggagagtttcagatct
cgagaggaggaagagggccaggaagggcaggatgccatgtccagagccaaagccaactgg
ttgcgagccttcaacaaggtgcgcatgcagctgcaggaggcccgaggagaaggggatatg
tctaagtctctatggttcaaaggcggtcctggtggtggccttatcatcattgacagcatg
ccagacatcaggaaacggaagcccattcccctcgtgagcgacctggctatgtcattggtg
cagtctcggaaggcaggcatcacctcggccttggcctccagcacgttgaacaatgaagag
ctgaaaaatcacgtttacaagaagaccctgcaagccttaatctaccccatctcctgcacc
acgccgcacaatttcgaggtgtggacggccaccacgcccacctactgctatgagtgcgag
gggctgctgtggggcatcgcgcggcagggcatgcgatgcaccgagtgcggcgttaagtgc
cacgagaagtgccaggacctgctcaatgcggattgcctgcagcgggcggctgagaagagt
tccaagcatggcgctgaagaccgcacgcagaacatcatcatggtgctgaaggaccgcatg
aagatccgcgagcgcaacaagcctgagatcttcgagcttatccaagagatcttcgcggtc
accaagagcgcacacacacagcagatgaaagctgtcaagcagagtgtgctggacggcaca
tccaagtggtctgccaaaattagcatcacagtggtctgtgcccagggcttgcaggccaag
gacaagacaggatccagtgacccttatgtcaccgtccaggttgggaagaccaagaaaagg
acaaaaaccatctacgggaacctcaacccagtgtgggaagagaattttcattttgaatgt
cacaactcctctgaccggatcaaggttcgtgtttgggatgaagatgacgacataaaatcc
cgtgtgaaacaaaggtttaagagggagtctgatgacttcctagggcagacaatcatcgag
gtgcggacgcttagcggcgagatggatgtgtggtacaatctggacaagagaacggacaag
tcggcggtgtcgggggccatccggcttcacatcagtgtggagatcaaaggggaggagaag
gtggcgccctaccatgtccagtacacctgtctgcatgagaacctgttccactttgtgacg
gacgtgcagaacaatggtgtggtgaagattcccgatgccaagggtgacgacgcctggaag
gtttactacgatgagacggcccaggagatcgtggatgagtttgccatgcgctatggtgtt
gagtccatctaccaagccatgacccactttgcctgcctctcctccaagtatatgtgccct
ggggtacccgctgtcatgagcaccctgcttgccaacatcaacgcctactacgcacacacc
accgcctccaccaacgtgtctgcctctgaccgcttcgctgcctctaatttcgggaaagag
cgctttgtgaaacttctggaccagctacacaattctctgcggatcgacctgtccatgtac
cggaacaacttcccagccagcagccctgagcggctgcaggatctcaagtccacggtggac
ctgctcaccagcatcaccttcttccggatgaaggttcaggaactgcagagcccgccgcgt
gccagccaggtagtgaaagactgtgtgaaggcctgcctcaactccacctatgagtacatc
ttcaacaactgccatgagctctatggccgggagtaccaaacggatccggccaagaagggg
gaggttcccccagaggagcaaggccctagcatcaagaacctggatttctggtccaagctg
atcaccctcatcgtgtctatcatcgaggaggataagaattcttacacaccctgcctcaat
cagtttccccaggagctcaatgtggggaagatcagtgctgaggtgatgtggagcctattt
gcccaagacatgaagtacgccatggaggaacatgacaaacaccggctgtgtaagagcgca
gattacatgaacctgcacttcaaggtgaagtggctgtacaatgagtacgtggccgagctg
cccaccttcaaggaccgtgtgcctgagtaccctgcgtggtttgagcccttcgtcatccag
tggttggatgagaatgaggaggtgtcccgggacttcctgcatggtgccctcgagcgggac
aagaaggacgggttccagcagacctcagagcacgccctgttctcttgctcagtggtggac
gtcttctcccagcttaaccagagtttcgagatcatcaagaagctggagtgtcctgacccc
cagatcgtgggccattacatgcggcgttttgccaagaccattagcaatgtgcttctccag
tatgcagacatcgtttccaaggacttcgcctcctactgctccaaggagaaggagaaagtg
ccctgcatcctcatgaacaacacacagcaactacgagtgcagctggagaagatgtttgag
gcgatgggcgggaaggagctggatgccgaggccagtggcaccctgaaggagctgcaggtg
aaactcaacaatgtcctggatgaactcagccatgtgtttgccaccagcttccagccacac
attgaggaatgcgtcagacagatgggtgacatcctgagccaggtgaagggcacaggcaat
gtacctgccagtgcctgcagcagcgtggcccaggatgcagacaatgtgctgcagcccatc
atggatcttctggacagcaacctcaccctgtttgccaaaatctgtgagaagacagttctg
aagcgggtgctgaaggagctctggaagctggtgatgaacacaatggagaagaccatcgtc
ctgccaccgctcactgaccagacgatgattggcaccctcttgagaaaacatggcaagggc
ctagaaaagggcagggtgaaactgccaagccactcagacgggacacaaatgatcttcaat
gctgccaaggagctgggccagctgtccaaacttaaggatcacatggtgcgggaagaagcc
aagagcttgaccccgaagcagtgtgctgttgttgaactggccctggacaccatcaagcaa
tacttccacgcggggggcgttggcctcaagaagaccttcctggagaagagcccggacctc
cagtccctgcgctacgccctgtcgctctacacgcaagccaccgacctgctcatcaaaacc
ttcgtgcagacgcagtcagcgcagggctctggtgtggaggaccctgtaggtgaagtgtcc
gtccacgtggagctgttcacacatccaggaactggggaacagaaggtcacagtgaaggtg
gtggccgccaatgacctcaagtggcagacttctggcatcttccgcccgttcatcgaggtc
aacatcgttggacctcagcttagcgacaagaaacgcaagttcgccaccaaatccaaaaac
aacagctgggcgcccaagtataacgagagcttccagttctccctgagcgccgacgcgggc
cccgagtgctacgagctgcaggtgtgcgtgaaggactactgctttgcgcgcgaagaccgc
acggtggggctggcggtgctgcaactgcgagagctggcccagcgcgggagcgccgcgtgc
tggcttccactcggccgccgcatccacatggacgacacggggctcacagtgctgcgcatc
ctgtcgcagcgcagcaacgatgaggtggccaaggaattcgtcaagctcaagtcggacacg
cgctcagccgaggagggcggtgccgcgcctgcgccctag

DBGET integrated database retrieval system