KEGG   Mus musculus (mouse): 209357
Entry
209357            CDS       T01002                                 

Gene name
Gtf2h3, 34kD, 34kDa, 5033417D07Rik, BTF2, BTF2_p34, C730029A10, D5Ertd679, D5Ertd679e, TFIIH
Definition
(RefSeq) general transcription factor IIH, polypeptide 3
  KO
K03143  transcription initiation factor TFIIH subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    209357 (Gtf2h3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    209357 (Gtf2h3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    209357 (Gtf2h3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    209357 (Gtf2h3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    209357 (Gtf2h3)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     209357 (Gtf2h3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     209357 (Gtf2h3)
SSDB
Motif
Pfam: Tfb4
Other DBs
NCBI-GeneID: 209357
NCBI-ProteinID: NP_852075
MGI: 1277143
Ensembl: ENSMUSG00000029387
Vega: OTTMUSG00000024483
UniProt: Q8VD76 Q3UZB8
Position
5 F; 5 63.67 cM
AA seq 309 aa
MAADEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANSHLFMNRSNQLAVI
ASHIQESRLLYPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM
TKSDIKGQHTETLLAGSLAKALCYIHRVNKAVKDNQEMKSRILVIKAAEDSALQYMNFMN
VIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRS
QLILPPPIHVDYRAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKA
KKKKQKVSL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggccgctgacgaagatgagttgaaccttctggtgatcatagttgacaccaacccgatt
tggtggggaaagcaagcattaaaggaatctcagtttactttatccaaatgcatggatgca
gtgatggtgctggcgaattctcacctgttcatgaaccgctccaaccagctggctgtcatc
gccagtcacattcaggaaagccggctcttatacccggggaagaacggtggacttggagac
ttcttcggagaccctggcaatgcgctccccgactgtaacccctctgggagtaaagatggg
aaatacgagctgttgacagttgcaaacgaggtgatcgctgaggagatcaaggatctgatg
accaagagtgacatcaagggccagcatacggagacactactggcaggatccctggccaaa
gctctgtgctacattcacagagtgaacaaggcagttaaagataatcaggagatgaaatca
aggattttggtgatcaaggctgcagaggacagcgcactgcagtacatgaacttcatgaac
gtcatctttgctgctcagaagcagaatatcctcatcgacgcctgcgtgctggactcggat
tcagggctcctccagcaggcttgtgacatcactgggggactgtacctgaaggtgcctcag
atgccttctctcctgcagtacttactgtgggtttttcttccggaccaagatcagcggtct
cagctaatcctcccacccccgatccacgtggactacagggctgcctgcttctgtcatcgc
agtctcattgagattggctatgtctgctctgtgtgtctgtctattttctgcaatttcagc
cccatctgcaccacgtgcgagacagcttttaagatctccctccctcctgtgctgaaggcc
aagaagaagaaacagaaggtgtccctgtga

DBGET integrated database retrieval system