KEGG   Mus musculus (mouse): 21687
Entry
21687             CDS       T01002                                 

Gene name
Tek, AA517024, Cd202b, Hyk, STK1, Tie, Tie-2, Tie2, tie-
Definition
(RefSeq) TEK receptor tyrosine kinase
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21687 (Tek)
   04014 Ras signaling pathway
    21687 (Tek)
   04015 Rap1 signaling pathway
    21687 (Tek)
   04066 HIF-1 signaling pathway
    21687 (Tek)
   04151 PI3K-Akt signaling pathway
    21687 (Tek)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    21687 (Tek)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21687 (Tek)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    21687 (Tek)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     21687 (Tek)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   21687 (Tek)
CD molecules [BR:mmu04090]
 Proteins
  21687 (Tek)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_Tie2_1 Pkinase fn3 Pur_ac_phosph_N EGF_2 APH hEGF DUF2369 Laminin_EGF DUF4702 Pkinase_fungal
Other DBs
NCBI-GeneID: 21687
NCBI-ProteinID: NP_001277478
MGI: 98664
Ensembl: ENSMUSG00000006386
Vega: OTTMUSG00000007859
UniProt: Q02858
Position
4 C5; 4 43.34 cM
AA seq 1122 aa
MDSLAGLVLCGVSLLLYGVVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGEC
ICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNE
ACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIE
VNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKK
LFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIG
LPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVL
LSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTI
VDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSS
NPAFSHELRTLPHSPASADLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRM
AQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKAR
IKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAI
EYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIH
RDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVW
SYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYER
PSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3369 nt   +upstreamnt  +downstreamnt
atggactctttagccggcttagttctctgtggagtcagcttgctcctttatggagtagta
gaaggcgccatggacctgatcttgatcaattccctacctcttgtgtctgatgccgaaaca
tccctcacctgcattgcctctgggtggcacccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaagatccactggaggttactcaagatgtgaccaga
gaatgggcgaaaaaagttgtttggaagagagaaaaggccagtaagattaatggtgcttat
ttctgtgaaggtcgagttcgaggacaggctataaggatacggaccatgaagatgcgtcaa
caagcatccttcctacctgctactttaactatgaccgtggacaggggagataatgtgaac
atatctttcaaaaaggtgttaattaaagaagaagatgcagtgatttacaaaaatggctcc
ttcatccactcagtgccccggcatgaagtacctgatattttagaagttcacttgccgcat
gctcagccccaggatgctggtgtgtactcggccaggtacataggaggaaacctgttcacc
tcagccttcaccaggctgattgttcggagatgtgaagctcagaagtgggggcccgactgt
agccgtccttgtactacttgcaagaacaatggagtctgccatgaagataccggggaatgc
atttgccctcctgggtttatggggagaacatgtgagaaagcttgtgagccgcacacattt
ggcaggacctgtaaagaaaggtgtagtggaccagaaggatgcaagtcttatgtgttctgt
ctcccagacccttacgggtgttcctgtgccacaggctggagggggttgcagtgcaatgaa
gcatgcccatctggttactacggaccagactgtaagctcaggtgccactgtaccaatgaa
gagatatgtgatcggttccaaggatgcctctgctctcaaggatggcaagggctgcagtgt
gagaaagaaggcaggccaaggatgactccacagatagaggatttgccagatcacattgaa
gtaaacagtggaaaatttaaccccatctgcaaagcctctgggtggccactacctactagt
gaagaaatgaccctagtgaagccagatgggacagtgctccaaccaaatgacttcaactat
acagatcgtttctcagtggccatattcactgtcaaccgagtcttacctcctgactcagga
gtctgggtctgcagtgtgaacacagtggctgggatggtggaaaagcctttcaacatttcc
gtcaaagttcttccagagcccctgcacgccccaaatgtgattgacactggacataacttt
gctatcatcaatatcagctctgagccttactttggggatggacccatcaaatccaagaag
cttttctataaacctgtcaatcaggcctggaaatacattgaagtgacgaatgagattttc
actctcaactacttggagccgcggactgactacgagctgtgtgtgcagctggcccgtcct
ggagagggtggagaagggcatcctgggcctgtgagacgatttacaacagcgtctatcgga
ctccctcctccaagaggtctcagtctcctgccaaaaagccagacagctctaaatttgact
tggcaaccgatatttacaaactcagaagatgaattttatgtggaagtcgagaggcgatcc
ctgcaaacaacaagtgatcagcagaacatcaaagtgcctgggaacctgacctcggtgcta
ctgagcaacttagtccccagggagcagtacacagtccgagctagagtcaacaccaaggcg
cagggggagtggagtgaagaactcagggcctggacccttagtgacattctccctcctcaa
ccagaaaacatcaagatctccaacatcactgactccacagctatggtttcttggacaata
gtggatggctattcgatttcttccatcatcatccggtataaggttcagggcaaaaatgaa
gaccagcacattgatgtgaagatcaagaatgctaccgttactcagtaccagctcaagggc
ctagagccagagactacataccatgtggatatttttgctgagaacaacataggatcaagc
aacccagccttttctcatgaactgaggacgcttccacattccccagcctctgcagacctc
ggagggggaaagatgctactcatagccatccttgggtcggctggaatgacttgcatcacc
gtgctgttggcgtttctgattatgttgcaactgaagagagcaaatgtccaaaggagaatg
gctcaggcattccagaacagagaagaaccagctgtgcagtttaactcaggaactctggcc
cttaacaggaaggccaaaaacaatccggatcccacaatttatcctgtgcttgactggaat
gacatcaagtttcaagacgtgatcggagagggcaactttggccaggttctgaaggcacgc
atcaagaaggatgggttacggatggatgccgccatcaagaggatgaaagagtatgcctcc
aaagatgatcacagggacttcgcaggagaactggaggttctttgtaaacttggacaccat
ccaaacatcattaatctcttgggagcatgtgaacaccgaggctatttgtacctagctatt
gagtatgccccgcatggaaacctcctggacttcctgcgtaagagcagagtgctagagaca
gaccctgcttttgccatcgccaacagtacagcttccacactgtcctcccaacagcttctt
cattttgctgcagatgtggcccgggggatggactacttgagccagaaacagtttatccac
agggacctggctgccagaaacattttagttggtgaaaactacatagccaaaatagcagat
tttggattgtcacgaggtcaagaagtgtatgtgaaaaagacaatgggaaggctcccagtg
cgttggatggcaatcgaatcactgaactatagtgtctatacaaccaacagtgatgtctgg
tcctatggtgtattgctctgggagattgttagcttaggaggcaccccctactgcggcatg
acgtgcgcggagctctatgagaagctaccccagggctacaggctggagaagcccctgaac
tgtgatgatgaggtgtatgatctaatgagacagtgctggagggagaagccttatgagaga
ccatcatttgcccagatattggtgtccttaaacaggatgctggaagaacggaagacatac
gtgaacaccacactgtatgagaagtttacctatgcaggaattgactgctctgcggaagaa
gcagcctag

DBGET integrated database retrieval system