KEGG   Mus musculus (mouse): 217069
Entry
217069            CDS       T01002                                 

Gene name
Trim25, AA960166, AL022677, EFP, Zfp14, Zfp147
Definition
(RefSeq) tripartite motif-containing 25
  KO
K10652  tripartite motif-containing protein 25 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    217069 (Trim25)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    217069 (Trim25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    217069 (Trim25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    217069 (Trim25)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     217069 (Trim25)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    217069 (Trim25)
SSDB
Motif
Pfam: SPRY PRY zf-RING_UBOX zf-C3HC4_4 zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-C3HC4_3 zf-RING_2 Prok-RING_4 zf-RING_10 zf-RING_6 U-box FTO_CTD zinc_ribbon_4 Noelin-1 DUF4407 TACC_C
Other DBs
NCBI-GeneID: 217069
NCBI-ProteinID: NP_033572
MGI: 102749
Ensembl: ENSMUSG00000000275
Vega: OTTMUSG00000001304
UniProt: Q61510
Structure
PDB: 
4B8E

Position
11; 11 C
AA seq 634 aa
MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCMSCLDETWVVQGPPYRCPQCRKVYQVR
PQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQVACDHCLTEIAVKTCLV
CMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLRELFCPEHGECICHICLV
EHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDVRSKQQCVQDSMKRKMEQL
RQEYMEMKAVIDAAETSSLRKLKEEEKRVYGKFDTIYQVLVKKKSEMQKLKAEVELIMDK
GDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGAADLKSELKHSIKKLQKKSEE
HNGSGNKGDQTQSTFKPVQPSKKTIQEKKTKKTPVAPGPPSHFSPNKLPTFGAPGQSLDS
KATSPDAAPKASAAQPDSVGVKAKVLENFLTKSRTELLEYFVKVIFDYNTAHNKVSLSNK
YTTASVSDGLQHYRSHPQRFTYCSQVLGLHCYKNGIHYWEVELQKNNFCGVGICYGSMER
QGPESRLGRNPNSWCVEWFNNKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVTE
KVHLMYKFKVDFTEALYPAFWVFSAGTTLSICSK
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggcggagctgaatcctctggccgaggagctgtcctgctccgtctgcctggagctcttc
aaggaacctgtcaccactccgtgcggccacaatttctgcatgtcatgcctggatgagacg
tgggtcgtccagggcccgccgtaccgatgcccgcaatgtcgcaaagtgtaccaggtgcgc
ccgcagctgcaaaagaacacggtaatgtgcgcggtggtggagcagttcctgcaggccgag
caggcgcggaccccggtggacgactggacgcctcctgcccgcttctccgcctccagcgca
gccacccaggtggcctgcgaccactgcctgacggagatcgcagtgaagacgtgcctcgtg
tgcatggcctctttctgccaggagcacttgaggcctcacttcgacagtccggccttccag
gatcaccccctacagtcgcccattcgtgaccttctgcgccgcaaatgtacccagcacaac
cgccttcgggaattgttttgtcccgagcatggcgagtgcatctgccatatctgcttggta
gagcacaagacctgctcccctacgaccctaagtcaagccagcgccgacctggagtacaaa
ctgaggaataaactcactatcatgcacagccacatcaatggggcaaccaaagcattggag
gatgtgagatccaagcaacagtgtgtgcaggattctatgaagaggaagatggaacagctg
agacaggagtatatggaaatgaaggctgtcatcgacgcagcagagaccagctccttgcgc
aagttaaaggaggaggagaagagagtctacggaaaattcgacaccatctaccaggttctc
gtcaagaagaagagtgagatgcagaaactgaaggcagaggttgagctcattatggacaaa
ggggatgagtttgagtttctggagaaagctgcaaaattgcaaggagagtcaacaaaacca
gtctacatccctaagatagatctggatcatgatttgataatgggaatctaccaaggggcg
gcggacctcaagagtgaactgaagcactccattaagaagctacagaagaagtctgaggag
cacaatggctcaggtaacaagggagaccagacacagtccacttttaaacccgtacaacct
tcgaagaagaccattcaagaaaagaagaccaagaaaacccctgttgctcccggccctccc
tcccacttctcacctaacaagttgcccacctttggagctcctggccaatcactggattca
aaagcaacttcccctgatgccgcacccaaagccagtgctgcacagccagactctgtagga
gtcaaggctaaggtgctagaaaacttcttaaccaagtccagaacggagcttctggagtat
ttcgtgaaagtcatcttcgactacaataccgcccacaacaaagtgtctctgtcaaacaag
tacaccaccgcctctgtgtccgatgggctccagcactaccggtcccatccccagaggttc
acctactgctctcaggtcctggggctgcactgctacaagaacggcattcactactgggag
gtggaactacagaagaacaacttctgcggcgtaggcatctgctacggcagcatggaacgg
cagggccccgagagccggctgggccgcaaccccaactcatggtgtgtggagtggttcaat
aacaagatctctgcctggcacaacaacgtggagaagactctgccctccaccaaggccact
cgagtcggcgtgctgctcaactgtgaccacggcttcgtcattttctttgcggtcaccgaa
aaggtgcacctgatgtacaagttcaaggtggacttcaccgaagctctgtacccagccttc
tgggtgttctcggccggtaccaccctctctatctgctccaaatag

DBGET integrated database retrieval system