KEGG   Mus musculus (mouse): 21762
Entry
21762             CDS       T01002                                 

Gene name
Psmd2, 9430095H01Rik, AA407121, TEG-190, Tex190
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 2
  KO
K03028  26S proteasome regulatory subunit N1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    21762 (Psmd2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    21762 (Psmd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    21762 (Psmd2)
   05012 Parkinson disease
    21762 (Psmd2)
   05014 Amyotrophic lateral sclerosis
    21762 (Psmd2)
   05016 Huntington disease
    21762 (Psmd2)
   05017 Spinocerebellar ataxia
    21762 (Psmd2)
   05020 Prion disease
    21762 (Psmd2)
   05022 Pathways of neurodegeneration - multiple diseases
    21762 (Psmd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    21762 (Psmd2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     21762 (Psmd2)
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep HEAT_2 THAP
Other DBs
NCBI-GeneID: 21762
NCBI-ProteinID: NP_598862
MGI: 1096584
Ensembl: ENSMUSG00000006998
Vega: OTTMUSG00000036488
UniProt: Q8VDM4 Q3TKV1
Position
16; 16 A3
AA seq 908 aa
MEEGGRDKTPVQSQQPSATTPSGADEKSSGKERRDAGEKDKEQELSEEDKQLQDELEMLV
ERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKC
FAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKAQ
REPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYV
PEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGR
HGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGG
SGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLW
DVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLG
SIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQ
TIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAY
AGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALI
AMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPE
VSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCP
YHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPL
PVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVIL
RKNPNYDL
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaggagggtggacgagacaagacacccgtgcagtcccaacagccctccgcgacaacc
cccagcggcgcggacgagaagtcgagtggcaaggagcgaagggatgccggggaaaaagac
aaagagcaggagctgtctgaggaggacaaacagcttcaagatgaactggagatgctcgtg
gagcgactcggggagaaagatacatctctatatcgaccagctctggaggaactgagaaga
caaattcgttcttctacaacttccatgacttcagtacccaagcctctcaaatttctgcgt
ccacactatggcaaattgaaggaaatctatgagaacatggcccctggggagaataagtgt
tttgcagctgacatcatctctgttttggccatgaccatgagtggtgagcgggagtgcctc
aagtatcggctcgtgggctcccaggaagaactggcgtcatggggccatgaatacgtcaga
catctggcaggagaggtggccaaggagtggcaggagctggatgatgcagagaaagcacag
cgggaaccactgcttaccttggtaaaggaaatcgtcccctacaacatggctcacaatgca
gagcacgaggcttgtgacctgctcatggaaattgagcaggtggacatgctagagaaggac
attgatgagaacgcctacgccaaggtctgcctctatctcaccagttgtgtgaattatgta
ccagaacctgagaactctgccctcctgcgctgcgccttgggcgtgttccgaaagtttagc
cgtttccctgaagctctgagattggcactgatgctcaatgacatggaactggtagaagac
attttcacttcctgcaaagatgtggtggtccagaagcagatggcattcatgctgggtcgg
catggagtgttcctggagctgagtgaagatgtagaggaatatgaagacctcacagaaatc
atgtccaatgtccagctcaacagcaacttcttggctttagctcgggagctggacatcatg
gagcccaaggtgcctgatgacatctacaaaacccacctagagaataacaggtttggtggc
agtggctctcaagtggattctgcacgaatgaacctagcctcctcttttgtaaatggcttt
gtgaatgcagcctttggtcaagataaactactgactgatgatggcaacaaatggctttac
aagaacaaggaccatgggatgctaagtgctgctgcgtctcttggcatgattctgctgtgg
gatgtggatggtggcctcacccagattgacaagtatctgtactcctctgaggactacatc
aagtcaggagctctccttgcctgtggtatcgtgaattctggagtccggaatgagtgtgat
cctgccctggcactgctttcagactatgttctccataacagcaataccatgagacttggc
tccatctttgggctaggtttggcctatgctggctctaatcgggaagatgttctaacactg
ctgctacctgtaatgggagattccaagtccagcatggaggtggcaggtgtgacggctcta
gcttgtgggatgatagcagtggggtcctgcaatggagatgtcacttccaccatccttcag
accatcatggagaaatctgagactgagctcaaggatacctatgctcgttggcttcctctt
ggcctgggcctcaatcacttggggaaaggcgaagctattgaggccatcctggctgccttg
gaggtggtgtcagagccattccgcagttttgccaataccctggtggatgtatgtgcctat
gcaggctctgggaatgtgctgaaggttcagcagctcctccacatctgtagtgagcacttt
gactctaaggaaaaggaggaagacaaagacaagaaggaaaagaaggacaaggacaagaag
gaagcccctgctgacatgggagcacatcagggagtagctgttctgggcattgcacttatt
gctatgggggaagagattggtgcagagatggcattgcgaacttttggtcacttgctgaga
tatggggagcctaccctccgtcgcgctgtacctttagcactggcactaatttctgtttca
aatccacgactcaacatcctggatacgctaagcaaattctctcatgatgctgatccagaa
gtttcctataactccatctttgctatgggcatggtgggcagtggtaccaataatgcccgt
ctggctgcaatgttgcgccagttagctcaatatcatgccaaggaccccaataacctcttc
atggtgcgcttggcacagggcttgacacatttagggaagggcacacttaccctctgcccc
tatcacagtgatcggcagctcatgagtcaagtagcggtggcagggctactcacggtgctt
gtttctttcctggatgttcgaaacatcatcctaggcaagtctcactatgtcctgtatggg
ctggtagccgccatgcagcctcggatgctggttacatttgatgaggagctgcgaccattg
ccagtttctgtccgtgtgggtcaggcagtggatgtggtgggccaggctgggaagccaaaa
acaatcacagggttccagactcatacaacgccagtgttgctggcccatggggagcgggca
gagttggccactgaggagtttcttcctgtcacccccattctggaaggctttgttattctt
cggaagaaccccaactatgatctttga

DBGET integrated database retrieval system