KEGG   Mus musculus (mouse): 21956
Entry
21956             CDS       T01002                                 

Symbol
Tnnt2, Tn, Tnt, cTn, cTnT
Name
(RefSeq) troponin T2, cardiac
  KO
K12045  troponin T, cardiac muscle
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    21956 (Tnnt2)
   04261 Adrenergic signaling in cardiomyocytes
    21956 (Tnnt2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    21956 (Tnnt2)
   05414 Dilated cardiomyopathy
    21956 (Tnnt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21956 (Tnnt2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     21956 (Tnnt2)
SSDB
Motif
Pfam: Troponin
Other DBs
NCBI-GeneID: 21956
NCBI-ProteinID: NP_001123648
MGI: 104597
Ensembl: ENSMUSG00000026414
Vega: OTTMUSG00000049830
UniProt: P50752 Q6P3Z7 Q54AB6
Position
1 E4; 1 59.32 cM
AA seq 301 aa
MSDAEEVVEEYEEEQEEEDWSEEEEDEQEEAVEEEEAGGAEPEPEGEAETEEANVEEVGP
DEEAKDAEEGPVEDTKPKPSRLFMPNLVPPKIPDGERVDFDDIHRKRVEKDLNELQTLIE
AHFENRKKEEEELISLKDRIEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRK
AEDEARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKALAIDHLNED
QLREKAKELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRW
K
NT seq 906 nt   +upstreamnt  +downstreamnt
atgtctgacgccgaggaggtggtggaggagtacgaggaggaacaggaagaggaagactgg
agtgaagaagaggaggacgagcaagaggaggcagtggaggaggaggaggctggtggggct
gaacctgagcctgagggtgaggctgagacagaggaggccaacgtagaagaggttggtcct
gatgaagaagccaaagatgctgaagaaggtccagtagaggacaccaaacccaagcccagc
aggctcttcatgcccaacttggtgccacccaagatccccgatggagagagagtggacttt
gatgacatccacaggaagcgcgtggagaaggacctgaatgagctacagactctgatcgag
gctcacttcgagaacaggaagaaggaggaagaggagctgatttccctcaaagacaggatc
gaaaagcgtcgggcagagcgggccgagcagcagcgtattcgcaatgagcgggagaaggaa
aggcagaaccgcctggctgaagagagggcccggcgtgaggaggaggagaacaggaggaag
gctgaggatgaggcccggaagaagaaggctctgtccaacatgatgcactttggagggtac
atccagaagcaagctcagacagagcggaagagtgggaagagacagacagagagagagaag
aagaagaagatcctggcagagaggaggaaggcgctggccatcgaccacctgaatgaagac
caactgagagagaaggccaaggagctgtggcagagtattcacaacctggaggctgagaag
ttcgacctgcaggaaaagttcaagcagcagaaatacgaaatcaacgttctgcgaaaccgg
atcaatgacaaccagaaagtctccaaaactcgtgggaaggccaaagtcaccgggcgttgg
aaatag

DBGET integrated database retrieval system