KEGG   Mus musculus (mouse): 22003
Entry
22003             CDS       T01002                                 

Symbol
Tpm1, AA986836, AI854628, TM2, TPM1kappa, Tm3, Tmpa, Tpm-1, alpha-TM
Name
(RefSeq) tropomyosin 1, alpha
  KO
K10373  tropomyosin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05206  MicroRNAs in cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    22003 (Tpm1)
   04261 Adrenergic signaling in cardiomyocytes
    22003 (Tpm1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    22003 (Tpm1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    22003 (Tpm1)
   05414 Dilated cardiomyopathy
    22003 (Tpm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22003 (Tpm1)
   04147 Exosome [BR:mmu04147]
    22003 (Tpm1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     22003 (Tpm1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   22003 (Tpm1)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd ERM Crescentin DUF745 CENP-F_leu_zip Laminin_I DUF3450 ATG16 AAA_13 DUF1664 COG2 DUF16 Golgin_A5 Lebercilin Fib_alpha XhlA
Other DBs
NCBI-GeneID: 22003
NCBI-ProteinID: NP_001157720
MGI: 98809
Ensembl: ENSMUSG00000032366
Vega: OTTMUSG00000020411
UniProt: P58771 Q545Y3
Position
9 C; 9 36.27 cM
AA seq 284 aa
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaagagaacgccttggat
cgagctgagcaagcggaggctgataagaaggcggcggaagaccggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaaactggagctggcggagaaaaaggccacagat
gctgaagctgacgtagcttctctgaacagacgcatccagctggttgaggaggagttggat
cgtgctcaggagcgtctggccacagctctgcagaagctggaggaggccgagaaggctgca
gatgagagtgagagaggcatgaaagtcattgaaagccgagcccaaaaagatgaagaaaag
atggagattcaggagatccagctgaaagaggccaagcacattgctgaagatgctgaccgg
aagtatgaagaggtggcccgtaagctggtcatcatcgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaacggtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactctcagaaggaagacaaa
tatgaagaggagatcaaggttctctctgacaagctgaaggaggctgaaactcgggctgag
tttgcagagagatcagtaaccaaattggagaaaagcattgatgacttagaagacgagctg
tatgctcagaaactgaagtacaaggccatcagcgaggagctggaccacgctctcaacgat
atgacttccatataa

KEGG   Mus musculus (mouse): 22004
Entry
22004             CDS       T01002                                 

Symbol
Tpm2, Tpm-2, Trop-2
Name
(RefSeq) tropomyosin 2, beta
  KO
K10374  tropomyosin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    22004 (Tpm2)
   04261 Adrenergic signaling in cardiomyocytes
    22004 (Tpm2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    22004 (Tpm2)
   05414 Dilated cardiomyopathy
    22004 (Tpm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22004 (Tpm2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     22004 (Tpm2)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II ERM Crescentin TMF_DNA_bd CENP-F_leu_zip YscO Cluap1 HrpB7 ATG16 FlaC_arch SlyX Laminin_I Suppressor_APC Lebercilin DUF16 AAA_13 ADIP DUF1664 Fib_alpha
Other DBs
NCBI-GeneID: 22004
NCBI-ProteinID: NP_033442
MGI: 98810
Ensembl: ENSMUSG00000028464
Vega: OTTMUSG00000006959
UniProt: P58774 Q9D1R6
Position
4; 4 A5
AA seq 284 aa
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKDAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
NT seq 855 nt   +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaaactggacaaggagaatgccatcgac
cgcgcggagcaggccgaagccgacaaaaagcaagctgaagaccgatgcaagcagctggag
gaagagcagcaggccctccagaagaagctgaaggggacagaggacgaggtggaaaagtat
tccgagtccgtgaaggatgcccaggagaaactggagcaggctgagaagaaggccaccgac
gctgaagcagatgtggcctctctgaaccgccgcattcagctcgtagaggaggagttggat
cgggcacaggagcgcctggctacagccttgcaaaagctggaggaggctgagaaagccgcg
gatgagagcgagagaggaatgaaggtcattgaaaaccgggccatgaaggatgaggaaaag
atggagctgcaggagatgcagctgaaggaagccaagcacatcgctgaggactcagaccgc
aaatatgaggaggtggccaggaagctggtgatcctggaaggggagctggagcgctcggaa
gagagagccgaggtggctgagagtaaatgtggggacctagaggaggagctgaaaattgtt
accaacaacttgaaatccctggaagcccaagcggacaagtattccaccaaagaggacaaa
tacgaagaagagatcaaacttctggaggagaagctgaaagaggctgagacccgagcagag
tttgctgaaagatctgtggcaaagttggagaaaaccattgatgatctggaagatgaagtc
tatgcacagaagatgaagtacaaggccatcagcgaggagctggacaacgcactcaatgac
atcacttccctctga

KEGG   Mus musculus (mouse): 326618
Entry
326618            CDS       T01002                                 

Symbol
Tpm4, 2610528G24Rik, Tpm4.2, Tpm4.2cy
Name
(RefSeq) tropomyosin 4
  KO
K10375  tropomyosin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    326618 (Tpm4)
   04261 Adrenergic signaling in cardiomyocytes
    326618 (Tpm4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    326618 (Tpm4)
   05414 Dilated cardiomyopathy
    326618 (Tpm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    326618 (Tpm4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     326618 (Tpm4)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CENP-F_leu_zip DUF3450 MscS_porin Crescentin TMF_DNA_bd CCDC144C GAS DUF724 Fib_alpha CLZ TPR_MLP1_2 DUF1664 EzrA ERM BicD DUF745 DHR10 ISG65-75 DUF948 FPP CALCOCO1 Lebercilin HrpB7 ADIP Flagellin_N PDE4_UCR
Other DBs
NCBI-GeneID: 326618
NCBI-ProteinID: NP_001001491
MGI: 2449202
Ensembl: ENSMUSG00000031799
Vega: OTTMUSG00000022549
UniProt: Q6IRU2
Position
8; 8 B3.3
AA seq 248 aa
MAGLNSLEAVKRKIQALQQQADDAEDRAQGLQRELDGERERREKAEGDAAALNRRIQLLE
EELDRAQEQLATALQNLEEAEKAADESERGMKVIENRAMKDEEKMEILEMQLKEAKHITD
EADRKYEEVARKLVILEGELKRAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSE
KEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEEKLAQAKEENVGLHQTLDQ
TLNELNCI
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccggcctcaactcactggaggcagtgaagcgcaagatccaggccctgcagcagcag
gcagacgacgcagaggatcgcgcgcaaggcctgcagcgcgaactggatggcgagcgcgag
cggcgcgagaaagctgaaggagatgcagccgctctcaaccgccgcatccaactgctggag
gaggaactggaccgggctcaggagcagctggccacagccctgcagaatctggaagaggca
gagaaggctgctgatgagagtgagagaggcatgaaggtaatagagaaccgagccatgaaa
gatgaggaaaagatggagatcctggagatgcagctcaaagaagccaagcacatcactgac
gaagccgaccgcaagtatgaggaggttgctcgtaagttggtcatcctggagggtgagctg
aagagagcagaggagagggcggaggtatctgaactaaagtgtggtgacctggaagaagag
ctcaagaatgtaactaacaatctgaaatcactggaggctgcttctgaaaagtattctgaa
aaggaggataaatatgaagaagaaatcaagcttctgtctgacaagctgaaggaggctgag
acccgagctgagtttgcagaaaggacagtttctaaactggagaagacaatcgatgacctg
gaagaaaaacttgcccaggccaaagaagagaatgtgggcttacatcagacactggaccag
acactaaacgaacttaactgtatataa

KEGG   Mus musculus (mouse): 59069
Entry
59069             CDS       T01002                                 

Symbol
Tpm3, TM30nm, TMnm, Tm5NM, Tpm-5, Tpm5, Trop-5, gamma-TM, hTM30nm, hTMnm
Name
(RefSeq) tropomyosin 3, gamma
  KO
K09290  tropomyosin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    59069 (Tpm3)
   04261 Adrenergic signaling in cardiomyocytes
    59069 (Tpm3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    59069 (Tpm3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    59069 (Tpm3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    59069 (Tpm3)
   05414 Dilated cardiomyopathy
    59069 (Tpm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    59069 (Tpm3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     59069 (Tpm3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ DUF745 TMF_DNA_bd Crescentin ERM HrpB7 XhlA ATG16 CENP-F_leu_zip DUF3450 DUF1664 DHR10 MscS_porin Golgin_A5 Lebercilin Laminin_I AAA_13 SlyX Spc7 EzrA
Other DBs
NCBI-GeneID: 59069
NCBI-ProteinID: NP_001280677
MGI: 1890149
Ensembl: ENSMUSG00000027940
Vega: OTTMUSG00000029647
UniProt: P21107
Position
3; 3 F1
AA seq 285 aa
MMEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaagagaatgttctg
gaccgagctgagcaagctgaagctgagcagaaacaggcagaagaaagaagcaagcagcta
gaggatgaactagcaaccatgcagaagaagctgaaagggacagaggatgagctggacaag
tattcggaagctttaaaggatgctcaggagaagctggagctagcagagaagaaggcagcc
gacgctgaagctgaggtggcctccttgaaccgcaggatccagctggttgaagaggagctg
gaccgtgcgcaggagcgccttgccactgctttgcagaagctggaggaagcagagaaggct
gctgatgagagtgagagaggtatgaaggtgattgaaaatcgggctctaaaagatgaagaa
aagatggaactccaggaaatccagctaaaggaagcaaagcacattgcagaagaggccgat
aggaagtatgaagaggtggctcgtaagttggtgattattgaaggagacttggaacgcacg
gaggaacgtgctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagac
aagtatgaagaagaaataaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgaaagatcggtagccaagctggagaagaccattgatgacctggaagacgag
ctctatgcccagaaactgaagtacaaggccattagcgacgagctggaccacgccctcaat
gacatgacctctatataa

DBGET integrated database retrieval system