KEGG   Mus musculus (mouse): 22035
Entry
22035             CDS       T01002                                 

Gene name
Tnfsf10, A330042I21Rik, AI448571, AP, APO-2L, Ly81, T, TL2, Tnlg6a, Trail
Definition
(RefSeq) tumor necrosis factor (ligand) superfamily, member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04068  FoxO signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu05132  Salmonella infection
mmu05164  Influenza A
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    22035 (Tnfsf10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    22035 (Tnfsf10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    22035 (Tnfsf10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    22035 (Tnfsf10)
   04217 Necroptosis
    22035 (Tnfsf10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22035 (Tnfsf10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    22035 (Tnfsf10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    22035 (Tnfsf10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    22035 (Tnfsf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22035 (Tnfsf10)
   04052 Cytokines and growth factors [BR:mmu04052]
    22035 (Tnfsf10)
   04090 CD molecules [BR:mmu04090]
    22035 (Tnfsf10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   22035 (Tnfsf10)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   22035 (Tnfsf10)
CD molecules [BR:mmu04090]
 Proteins
  22035 (Tnfsf10)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 22035
NCBI-ProteinID: NP_033451
MGI: 107414
Ensembl: ENSMUSG00000039304
Vega: OTTMUSG00000037571
UniProt: P50592 Q3U5H0
Position
3; 3 A3
AA seq 291 aa
MPSSGALKDLSFSQHFRMMVICIVLLQVLLQAVSVAVTYMYFTNEMKQLQDNYSKIGLAC
FSKTDEDFWDSTDGEILNRPCLQVKRQLYQLIEEVTLRTFQDTISTVPEKQLSTPPLPRG
GRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVI
EQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSC
WSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
NT seq 876 nt   +upstreamnt  +downstreamnt
atgccttcctcaggggccctgaaggacctcagcttcagtcagcacttcaggatgatggtg
atttgcatagtgctcctgcaggtgctcctgcaggctgtgtctgtggctgtgacttacatg
tacttcaccaacgagatgaagcagctgcaggacaattactccaaaattggactagcttgc
ttctcaaagacggatgaggatttctgggactccactgatggagagatcttgaacagaccc
tgcttgcaggttaagaggcaactgtatcagctcattgaagaggtgactttgagaaccttt
caggacaccatttctacagttccagaaaagcagctaagtactcctcccttgcccagaggt
ggaagacctcagaaagtggcagctcacattactgggatcactcggagaagcaactcagct
ttaattccaatctccaaggatggaaagaccttaggccagaagattgaatcctgggagtcc
tctcggaaagggcattcatttctcaaccacgtgctctttaggaatggagagctggtcatc
gagcaggagggcctgtattacatctattcccaaacatacttccgatttcaggaagctgaa
gacgcttccaagatggtctcaaaggacaaggtgagaaccaaacagctggtgcagtacatc
tacaagtacaccagctatccggatcccatagtgctcatgaagagcgccagaaacagctgt
tggtccagagatgccgagtacggactgtactccatctatcagggaggattgttcgagcta
aaaaaaaatgacaggatttttgtttctgtgacaaatgaacatttgatggacctggatcaa
gaagccagcttctttggagcctttttaattaactaa

DBGET integrated database retrieval system