KEGG   Mus musculus (mouse): 22337
Entry
22337             CDS       T01002                                 

Symbol
Vdr, Nr1i1
Name
(RefSeq) vitamin D (1,25-dihydroxyvitamin D3) receptor
  KO
K08539  vitamin D3 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04978  Mineral absorption
mmu05152  Tuberculosis
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    22337 (Vdr)
  09154 Digestive system
   04978 Mineral absorption
    22337 (Vdr)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    22337 (Vdr)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    22337 (Vdr)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    22337 (Vdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    22337 (Vdr)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22337 (Vdr)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    22337 (Vdr)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     22337 (Vdr)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    22337 (Vdr)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   22337 (Vdr)
SSDB
Motif
Pfam: zf-C4 Hormone_recep zf-RRPl_C4
Other DBs
NCBI-GeneID: 22337
NCBI-ProteinID: NP_033530
MGI: 103076
Ensembl: ENSMUSG00000022479
Vega: OTTMUSG00000026431
UniProt: P48281
Position
15; 15 F1
AA seq 422 aa
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPIRADVSTGSYSPRPTLSFSGDSSS
NSDLYTPSLDMMEPASFSTMDLNEEGSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFA
KMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTLDDMSWDCGSQDYKYDITDVSRAGH
TLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQT
YIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNE
IS
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggaggcaatggcagccagcacctccctgcctgaccctggtgactttgaccggaatgtg
cctcggatctgtggagtgtgtggagaccgagccacgggcttccacttcaacgctatgacc
tgtgaaggctgcaagggtttcttcaggcggagcatgaagcgcaaggccctgttcacctgc
cccttcaatggagattgccgcatcaccaaggacaaccggcgacactgccaggcctgccgg
ctcaaacgctgcgtggacattggcatgatgaaggagttcatcctcacagatgaggaggtg
cagcgtaagcgagagatgatcatgaagaggaaggaggaagaggccttgaaggacagtctg
aggcccaagctgtctgaggagcaacagcacattatcgccatcctgctcgatgcccaccac
aagacctacgaccccacctatgccgacttccgggacttccggcctccaattcgtgcagac
gtaagtacagggagctattctccaaggcccacactcagcttctccggagactcctcctca
aactctgatctgtacaccccctcactggacatgatggaaccggccagcttttccacgatg
gatctgaatgaagaaggctccgatgacccctctgtgaccctggacctgtctccgctctcc
atgctgccccacctggctgatcttgtcagttacagcatccaaaaggtcatcggctttgcc
aagatgatccctggcttcagggacctcacctctgatgaccagattgtcctgcttaagtca
agtgccattgaggtgatcatgttgcgctccaaccagtcttttaccttggatgacatgtcc
tgggactgtggcagccaagactacaaatatgacatcactgatgtctccagagctgggcac
accctggagctgatcgaacccctcataaagttccaggtggggctgaagaagctgaacctc
catgaggaagaacatgtgctgctcatggccatctgcattgtctccccagaccgacctggg
gtacaggatgctaagctggttgaagccattcaggaccgcctatccaacacactgcagacc
tacatccgctgccgccacccgcccccgggcagccaccagctctacgccaagatgatccag
aagctggctgacctgcgaagcctcaatgaggagcactccaaacagtaccgttccctctcc
ttccagccggagaacagcatgaagctcacaccccttgtgctagaggtgttcggcaatgag
atctcctga

DBGET integrated database retrieval system