KEGG   Mus musculus (mouse): 228769
Entry
228769            CDS       T01002                                 

Gene name
Psmf1, AW048666, BC012260, PI, PI31
Definition
(RefSeq) proteasome (prosome, macropain) inhibitor subunit 1
  KO
K06700  proteasome inhibitor subunit 1 (PI31)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    228769 (Psmf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    228769 (Psmf1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    228769 (Psmf1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PI31
    228769 (Psmf1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   228769 (Psmf1)
SSDB
Motif
Pfam: PI31_Prot_N PI31_Prot_C
Other DBs
NCBI-GeneID: 228769
NCBI-ProteinID: NP_997611
MGI: 1346072
Ensembl: ENSMUSG00000032869
Vega: OTTMUSG00000015817
UniProt: Q8BHL8 A2AU35
Position
2; 2 G3
AA seq 271 aa
MAGLEVLFASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPGPSDKKSELLPAKWNS
NKELYALRYESKDGARKLLLKAVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDF
HRTYKNSEELRSQIRSGIITPIHEQWEKARANSPPREFPPATAREVDPLQISSHRPHTSR
QPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDPLRSGFPRVLIDPSSGLPNRLPPGAVPPG
ARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcgggtctcgaggttctcttcgcgtcggccgctccatccatgagctgcccgcaggac
gcactcgtctgcttcctgcactgggaagtggtgacaaacggctactatgccttgggcacg
ggcgaccagccaggtcccagtgataagaaatcagaactactgccagctaagtggaacagc
aataaagaactgtatgccctccggtatgagtctaaggatggagccagaaaactccttctg
aaagctgtctctgtggagaacggcatgatcatcaacgtgctggaacttggcacacagcag
gtggcagacttgaccctgaacttagatgattatattgatgcagaagacctgagtgacttc
cacaggacctataagaacagtgaggagcttcggtctcagatcagatctggaattatcaca
cctatccatgagcagtgggagaaggctcgtgcaaacagtcctccgagggagttcccacct
gccactgccagagaggtggacccactccagatttcctcacaccgtcctcatactagcagg
cagcctgcttggcgtgatcccctgagcccatttgctgtcgggggagatgacctagaccct
tttgggtgtcagagaggtggcatgattgtggatcccctgagatccggcttcccaagagta
cttattgacccatcctcaggcctcccaaaccggcttcctcctggtgctgtgcccccagga
gctcgctttgacccctttggacccattgggaccagcccatctggacctaaccctgaccat
cttcccccaccgggctacgatgacatgtacctgtga

DBGET integrated database retrieval system