KEGG   Mus musculus (mouse): 231691
Entry
231691            CDS       T01002                                 

Gene name
Sds, 4432411H13Rik, SD, SDH
Definition
(RefSeq) serine dehydratase
  KO
K17989  L-serine/L-threonine ammonia-lyase [EC:4.3.1.17 4.3.1.19]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu00290  Valine, leucine and isoleucine biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    231691 (Sds)
   00270 Cysteine and methionine metabolism
    231691 (Sds)
   00290 Valine, leucine and isoleucine biosynthesis
    231691 (Sds)
Enzymes [BR:mmu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     231691 (Sds)
    4.3.1.19  threonine ammonia-lyase
     231691 (Sds)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 231691
NCBI-ProteinID: NP_663540
MGI: 98270
Ensembl: ENSMUSG00000029597
Vega: OTTMUSG00000025315
UniProt: Q8VBT2 Q3UEN6
Position
5; 5 F
AA seq 327 aa
MAAQESLHVKTPLRDSMALSKLAGTSVFLKMDSSQPSGSFKIRGIGHLCKMKAKQGCRHF
VCSSAGNAGMATAYAARRLGIPATIVVPNTTPALTIERLKNEGATVEVVGEMLDEAIQVA
KALEKNNPGWVYISPFDDPLIWEGHTSLVKELKETLSAKPGAIVLSVGGGGLLCGVVQGL
REVGWEDVPIIAMETFGAHSFHAAIKEGKLVTLPKITSVAKALGVNTVGAQTLKLFYEHP
IFSEVISDQEAVSALEKFVDDEKILVEPACGAALAAVYSRVVCRLQDEGRLQTPLASLVV
IVCGGSNISLAQLQALKVQLGLNGLPE
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctgcccaggagtccctgcatgtgaagaccccacttcgtgacagcatggcgttgtcc
aaattggccggcaccagcgtgttcctaaaaatggacagctcccagccctcaggctccttc
aagatccgaggcattgggcatctctgcaagatgaaagcaaaacaaggctgtagacatttt
gtctgttcttcagctggcaacgcgggcatggcgaccgcctacgctgccaggaggctgggc
atcccagccactatcgttgtgcccaacaccacacctgccctcaccattgagcggctcaag
aatgaaggcgccacagttgaagtggtgggagagatgctggatgaggccatccaagtggcc
aaggctctggaaaagaacaacccgggttgggtgtacatttccccctttgatgaccctctc
atctgggaaggccacacttcccttgtgaaagagctgaaggagacgctgagcgccaagccc
ggggctatcgtgctgtctgtgggcggtggaggcctgctgtgcggagtggtccaggggctg
cgggaggtgggctgggaggatgtgcccatcatcgccatggagacctttggcgcccacagc
ttccatgctgccatcaaggaaggaaagctggtcaccctgcccaagatcaccagtgtcgcc
aaggccttgggcgtgaacactgtcggggcgcagaccctgaagctgttttacgaacacccc
attttctccgaggtcatctcagaccaggaggctgtgtctgctcttgagaagttcgtggac
gatgagaagattctggtggagcccgcgtgcggcgcggcgctggctgctgtgtacagccgc
gtggtgtgcaggctgcaggatgaaggccggctgcaaaccccactggcctcgctggttgtc
atcgtgtgtggcggcagcaacataagcctggcgcagctgcaggcactcaaggtgcagctg
ggcctgaacgggctgcccgagtga

KEGG   Mus musculus (mouse): 257635
Entry
257635            CDS       T01002                                 

Gene name
Sdsl, 4432411H13Rik, AI504310, SDH1, SDS, SDS-RS1, TDH
Definition
(RefSeq) serine dehydratase-like
  KO
K17989  L-serine/L-threonine ammonia-lyase [EC:4.3.1.17 4.3.1.19]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu00290  Valine, leucine and isoleucine biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    257635 (Sdsl)
   00270 Cysteine and methionine metabolism
    257635 (Sdsl)
   00290 Valine, leucine and isoleucine biosynthesis
    257635 (Sdsl)
Enzymes [BR:mmu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     257635 (Sdsl)
    4.3.1.19  threonine ammonia-lyase
     257635 (Sdsl)
SSDB
Motif
Pfam: PALP AIRC Peripla_BP_6 DAGK_cat
Other DBs
NCBI-GeneID: 257635
NCBI-ProteinID: NP_598663
MGI: 2182607
Ensembl: ENSMUSG00000029596
Vega: OTTMUSG00000025284
UniProt: Q8R238
Position
5; 5 F
AA seq 329 aa
MEGALAERVGAEPFHRVTPLLESWALSQVAGMPVFLKYENVQIAGSFKIRGIGHFCQQMA
KRGCRHLVCSSGGNAGIAAAYSARKLGIPVTIVLPEGTSVQVVRRLEGEGAEVQLTGKVW
DEANVKAQELATRDGWVNVSPFDHPLIWEGHASLVRELKESLGTPPGAVVLAVGGGGLLA
GVTAGLLEVGWQHVPIVAMETRGAHSFNSALQAGRPVTLPDITSVAKSLGAKTVAARTLE
CAKECEVLSEVVEDREAVSAVQRFLDDERMLVEPACGAALAAIYSGILWRLQAEGRLSSA
LASVVVIVCGGNNISSQQLQELKIQLGCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atggagggggccttggcagaacgcgtcggggcggagcctttccacagggtcacgcccctg
ctggagagctgggcgctgtctcaggtggcaggcatgccggtcttcctcaaatatgagaat
gtgcagatagctggctcctttaagattcggggcatcggacatttctgccagcagatggcc
aagaggggatgcagacatctggtgtgctcctcagggggcaatgcgggcattgcggctgca
tactcggctcgtaagctgggcatccccgtcaccatcgtgctcccagagggcacctccgtg
caggtggtgaggcggctcgagggggaaggggccgaggtccagctgactgggaaagtctgg
gatgaagccaatgtaaaagcacaagaactggccacaagggatggctgggtgaacgtctcc
ccgtttgaccatccccttatatgggaaggccatgccagcctagtgcgggagctgaaggag
tcactagggacccctccaggtgctgtggtgctggccgtggggggcggagggctcctggca
ggtgtgactgctggcctgctggaggtgggctggcagcatgtgcccatcgttgccatggag
acccgcggggcgcacagtttcaattcggccttgcaggcaggcaggccggtcaccctgcca
gacatcaccagtgtagccaagagcctcggagccaagacggtggctgcacggaccttggag
tgtgcaaaggagtgtgaggtcctctctgaggtggtagaagaccgggaggctgtcagcgct
gtgcagaggttcctggacgatgagcgcatgctggtggaacctgcctgcggtgccgccctg
gccgccatctactcgggcatcctgtggaggctccaggctgagggccgcctgagttctgcc
ctagcttccgttgtggtcatcgtgtgcggtggcaacaacattagtagccaacagcttcag
gagctgaaaatccagctgggctgcagctga

DBGET integrated database retrieval system