KEGG   Mus musculus (mouse): 236727
Entry
236727            CDS       T01002                                 

Symbol
Slc9a7, 6330509M05Rik, A530087D17Rik, AI450287, NHE7
Name
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 7
  KO
K12041  solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    236727 (Slc9a7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    236727 (Slc9a7)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   236727 (Slc9a7)
SSDB
Motif
Pfam: Na_H_Exchanger
Other DBs
NCBI-GeneID: 236727
NCBI-ProteinID: NP_796327
MGI: 2444530
Ensembl: ENSMUSG00000037341
Vega: OTTMUSG00000017060
UniProt: Q8BLV3
Position
X; X A1.3
AA seq 726 aa
MEPSDAARPGPGRAFRGLSPRLLLLPLLPVLLGRGLRAGAAASSGAAAEDSSAMEELATE
KEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGT
PATSGHDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGKINNVEQNDMLRKVTFDP
EVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIV
GQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSS
SIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVVTALVTKFTKLHCFPLL
ETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRSKQLFEVLHFL
AENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNF
QHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWVIGGGTTPMLSWLNIRV
GVEELSEEDQNENRWQYFRVGVDPDQDPPPNNDSFQVLQGDGMDSVGGSRTKQESAWIFR
LWYIFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLREDDSDFILTEG
DLTLTYGDSTVTANGSSSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVF
PLQENA
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggagcctagtgacgcggcgcgcccgggtcccgggagagcttttcgggggctgtcgccg
cggctgctgctgctgccactgttgcctgtgctgctgggtcgggggctgcgggctggggcc
gcggcctcctctggggcggcggctgaggacagcagcgccatggaggagcttgccaccgag
aaggaggcggaggagagccaccggcaggacagcgtgagcctgctcaccttcatcctgctg
ctcaccctcaccatcctcaccatctggcttttcaagcaccgccgggtgcgtttccttcat
gagaccgggctggccatgatttatgggctcattgttggagtgatcctgagatatggcacc
cctgctaccagcggtcatgacaagtcactcagctgtactcaggaagacagagcctttagc
actttattagtgaatgtcagtgggaagttctttgaatacactctgaaaggagaaatcagc
cctggcaagatcaacaacgtggagcagaatgacatgctgcggaaggtaacatttgatcca
gaggtatttttcaacattctgctgcctccaattattttccatgctggatacagcttaaag
aagagacactttttcagaaatcttgggtcgattctggcctatgctttcttggggactgct
gtttcttgcttcattattggaaatcttatgtatggagtggtgaaactcatgaagattgtg
ggccagctctctgataaattttactacacagattgtctcttttttggagcaattatttct
gccactgacccagtgactgtgctggcaatctttaacgaactacatgcagatgtggatctt
tatgctcttctgtttggagagagtgtcctgaatgatgcagttgccattgtactatcctcg
tctattgttgcctatcaaccagcaggactaaacactcatgcgtttgatgctgctgccttt
tttaagtcagttggcattttcctaggtatatttagtggctcttttaccatgggagctgta
actggtgttgttactgctctagtgaccaagtttactaagctgcactgcttccccctgctg
gagacagcgctttttttcctgatgtcctggagtacctttctcctggcggaagcctgtggg
tttacaggtgttgtagctgtccttttctgtgggattacacaagctcattacacatataac
aacctgtcagtagaatctcgaagtcgaagcaagcagctttttgaggtgttacacttcctg
gcagagaacttcatcttttcctacatgggcctggcactgttcaccttccagaaacacgtt
ttcagccccattttcatcatcggtgcttttgttgccatcttcctgggaagagctgcacat
atctacccactctccttcttcctcaacttgggcagaaggcataagattggctggaatttt
caacacatgatgatgttttcaggcctgagaggagcgatggcatttgcactggctatccgt
gacacggcatcgtatgcccgccagatgatgttcacaaccacactgctcattgtcttcttc
actgtgtgggtcattggtggaggcacgacacccatgttgtcatggctcaatataagagtt
ggtgtggaggagctctctgaagaggaccagaatgagaaccgatggcagtacttcagagtc
ggtgttgacccagatcaagacccaccacctaacaatgacagctttcaagtcttacaaggg
gatggcatggattctgttggaggaagccggacaaagcaggaaagtgcatggatattcagg
ctgtggtacatctttgatcataattacttgaagcccattctcacccacagtggtcccccg
ctaaccaccactctccctgcctggtgtggcttgctagctcgatgtctgaccagtcctcag
gtgtatgataatcaagagccactgagagaagatgactctgatttcatcctaacggaaggt
gacctcaccttgacctatggggatagcaccgtgacagcaaatggctcctcaagctcctac
acagcctccacaagtctcgagtgtggtcggagaacaaaaagcagctctgaggaagtactt
gagcgagacctgggaatgggagaccagaaggtttccagccggggaacccccctcgtgttt
ccactgcaggaaaatgcatga

KEGG   Mus musculus (mouse): 236794
Entry
236794            CDS       T01002                                 

Symbol
Slc9a6, 3732426M05, 6430520C02Rik, NHE6, mKIAA0267
Name
(RefSeq) solute carrier family 9 (sodium/hydrogen exchanger), member 6
  KO
K12041  solute carrier family 9 (sodium/hydrogen exchanger), member 6/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    236794 (Slc9a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    236794 (Slc9a6)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   236794 (Slc9a6)
SSDB
Motif
Pfam: Na_H_Exchanger Reo_sigmaC Stevor
Other DBs
NCBI-GeneID: 236794
NCBI-ProteinID: NP_001345790
MGI: 2443511
Ensembl: ENSMUSG00000060681
Vega: OTTMUSG00000017578
Position
X; X A5- A6
AA seq 649 aa
MDEEIVSEKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLV
GLVLRYGIHVPSDVNNVTLSCEVQSSPTTLLVNVSGKFYEYTLKGEISSHELNNVQDNEM
LRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYG
CVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLND
AVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAATGVVTALVTKFT
KLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYNNLSTESQHRTKQ
LFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFIAIFLGRAANIYPLSLLLNLGR
RSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIVFFTVWVFGGGTTAM
LSCLHIRVGVDSDQEHLGVPDNERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTT
LPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTESATASAPRRF
MGNSSEDALDRELTFGDHELVIRGTRLVLPMDDSEPALNSLDDTRHSPA
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggacgaggagatcgtgtccgagaagcaggcggaggagagccatcggcaggacagcgcc
aacctgctcatcttcatcctgctgctcaccctcaccattctgacgatctggctcttcaag
caccgccgggcccgcttcctgcacgaaaccggccttgctatgatttatggtcttttggta
ggcctcgtgcttcggtacggcattcatgttccaagcgatgtgaataatgtgactctgagc
tgtgaagtgcagtcaagtccaactaccttgttggtcaacgtcagtggaaaattttatgag
tatacgctgaaaggagagattagctcacatgaactcaacaatgttcaagataatgaaatg
cttaggaaggttacttttgatccagaagtctttttcaacatactgcttcctcctatcata
ttttatgcagggtacagtctcaaaaggagacatttcttccggaaccttgggtctatctta
gcatatgcctttcttggaacagcaatttcttgtttcgttattgggtccatcatgtatggc
tgtgtaaccctgatgaaggtgaccgggcagctcgcgggagatttttactttacagattgc
ttgctgtttggtgccattgtttcagccaccgacccagtgactgttcttgccatcttccat
gagcttcaagttgacgttgaactctacgctcttctcttcggggaaagtgtcctcaatgac
gcggttgccatagtgctgtcctcctcaatagtggcataccagccagcgggagacaacagc
cacacctttgacgttacagccatgttcaaatctattggaatcttccttgggatcttcagt
ggatcttttgcaatgggtgctgcaacaggcgtggtaacagctttagtgacaaagttcaca
aagctgagagagttccagctgttggagacaggccttttcttcttgatgtcctggagcacc
tttcttctggctgaagcatggggtttcacaggtgtggttgcagtattgttttgtggcatc
acacaagcacattacacgtacaataatttgtctacagagtctcagcatagaacaaagcag
ttgtttgagcttctcaattttttagcggagaatttcatcttttcctacatggggctgacg
ctgttcaccttccagaatcacgtctttaacccaacatttgtcgtaggagcattcattgct
attttcttgggaagagctgccaatatttatcccttgtctctcttacttaatttgggtaga
agaagtaagattggatcaaattttcaacacatgatgatgtttgctggtcttcgtggtgca
atggcatttgccttggccattcgagatactgccacttatgcacgacaaatgatgttcagc
accacacttctgatcgtgttttttactgtgtgggtatttggtggtggcaccactgccatg
ctgtcatgcctgcatataagggttggtgttgattcagaccaagaacatttgggtgttcct
gacaacgaaaggagaaccaccaaagcagagagtgcctggctctttcggatgtggtacaac
ttcgatcataactatctgaagcccctgctgacccacagtgggcctcctctgactaccaca
ctcccagcctgctgtgggccaatcgccaggtgcctgaccagcccccaagcatatgaaaac
caggagcagttgaaagatgatgactctgatctcattctcaatgatggtgatatcagtctg
acatatggggattctactgtgaacaccgagtccgcaacagccagcgccccaaggagattt
atgggcaacagttctgaagatgccttggaccgggagcttacatttggggaccacgaacta
gtcattcgtggcacacgcctggttcttccgatggatgattctgaacctgcgttaaattca
ttagatgatacgagacacagtccggcctaa

DBGET integrated database retrieval system