KEGG   Mus musculus (mouse): 23894
Entry
23894             CDS       T01002                                 

Gene name
Gtf2h2, 44kD, 44kDa, BTF2_p44, BTF2-p44, Btf2p4, Btf2p44, p4, p44
Definition
(RefSeq) general transcription factor II H, polypeptide 2
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    23894 (Gtf2h2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    23894 (Gtf2h2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    23894 (Gtf2h2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    23894 (Gtf2h2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    23894 (Gtf2h2)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     23894 (Gtf2h2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     23894 (Gtf2h2)
SSDB
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA VWA_3 HscB_4_cys IBR
Other DBs
NCBI-GeneID: 23894
NCBI-ProteinID: NP_071294
MGI: 1345669
Ensembl: ENSMUSG00000021639
Vega: OTTMUSG00000023202
UniProt: Q9JIB4 Q7TPV0
Position
13 D1; 13 53.21 cM
AA seq 396 aa
MDEEPERTKRWEGGYERTWEILKEDETGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKTAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDETHYKELLAHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDNNSTEPGLTLGGYFCPQCRAKYC
ELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEISLEEYKGERFCYGCQGELKDQHVYV
CTVCQNVFCVDCDVFVHDSLHCCPGCIHKIPTPSGI
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggatgaagaacctgagagaaccaagcggtgggaaggaggctatgagagaacctgggaa
attcttaaagaagatgaaactggatcacttaaagctacaatagaagatattctcttcaag
gcaaagaggaaaagagtgtttgagcaccatggacaagtccgacttggaatgatgcgccac
ctgtatgtggtggtggatggatcgagaacaatggaagatcaggatttaaagcccaataga
ctgacttgcactttaaagttgctggaatactttgtagaagaatattttgatcaaaaccct
atcagtcagattggaataattgtaactaagagtaaaagagctgaaaaactgactgaactc
tcaggaaacccaaggaaacatataacatctttgaagaaagctgtagatatgacctgccat
ggagaaccatcgctctataattccttaagcatggctatgcagaccctaaaacacatgcct
ggacatacaagtagagaagtgctcatcatcttcagcagcctcaccacctgtgatccatct
aatatttacgatctcatcaagaccctgaagacagctaaaattagagtgtctgttattgga
ttatctgcggaggttcgagtttgtactgtacttgctcgtgaaactggtggcacataccat
gttatcttagatgaaacccattacaaggagttgttggcacatcatgtgagcccccctcct
gccagctcaagctccgagtgctcactcattcgcatgggattccctcagcataccattgct
tctttgtctgatcaggatgcaaaaccatccttcagcatggcgcatttggataacaacagc
actgagccagggcttacactgggaggctacttctgcccacagtgccgagcaaagtactgc
gagcttcctgttgaatgtaaaatatgtggtcttactttggtgtctgcacctcatttggca
agatcttaccatcatttatttcctttggatgcttttcaagaaatttccctagaagaatat
aaaggagaaaggttttgttatggatgtcagggggaattgaaagaccaacatgtctatgtt
tgcacagtgtgccaaaatgttttttgtgtggactgtgatgtctttgttcatgactctctc
cattgttgtcctggctgtattcataagatcccaactccttcaggtatttaa

DBGET integrated database retrieval system