KEGG   Mus musculus (mouse): 23988
Entry
23988             CDS       T01002                                 

Gene name
Pin1, 0610025L01Rik, D9Bwg1161e
Definition
(RefSeq) protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    23988 (Pin1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    23988 (Pin1)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    23988 (Pin1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     23988 (Pin1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     23988 (Pin1)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    23988 (Pin1)
SSDB
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 MBD
Other DBs
NCBI-GeneID: 23988
NCBI-ProteinID: NP_075860
MGI: 1346036
Ensembl: ENSMUSG00000032171
Vega: OTTMUSG00000062734
UniProt: Q9QUR7
Position
9 A3; 9 7.6 cM
AA seq 165 aa
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCS
HLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKA
RGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccaccaggctgggagaagcgtatgagtcgcagctcaggc
cgggtgtactacttcaatcacatcaccaacgccagccagtgggagcggcccagcggcggc
agcactgttggaggcagcagcaagaatggccagggtgagcctgccaaggtgcgctgctca
catctgctggtgaagcacagccagtctcggaggccctcatcctggcggcaggaaaagatc
accaggagcaaggaggaggccctggagctcatcaatggctatatccagaagattaagtca
ggagaggaagactttgaatctctggcctcacagttcagtgattgcagctctgccaaagcc
aggggagacctgggtcccttcagcagaggtcagatgcagaaaccatttgaggatgcgtcg
tttgctctacggacaggggagatgagtgggcccgtgttcacggactcgggcatccatatc
atcctgcgcacagaatga

KEGG   Mus musculus (mouse): 241593
Entry
241593            CDS       T01002                                 

Gene name
Pin1rt1, P, Pin, Pin1-ps1, Pin1l
Definition
(RefSeq) protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, retrogene 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    241593 (Pin1rt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    241593 (Pin1rt1)
   03110 Chaperones and folding catalysts [BR:mmu03110]
    241593 (Pin1rt1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     241593 (Pin1rt1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     241593 (Pin1rt1)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    241593 (Pin1rt1)
SSDB
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 MBD
Other DBs
NCBI-GeneID: 241593
NCBI-ProteinID: NP_001028940
MGI: 3649546
Ensembl: ENSMUSG00000074997
Vega: OTTMUSG00000014964
UniProt: Q3ULQ2
Position
2 E2; 2
AA seq 159 aa
MADEKLPPGWKKYMSRSSGREYYFNHITNASQWERPSEGSSKNGQGEPARVRCSHLLVKH
SQSRRPSSWRQEKITRSKEEALELINGYIRKIKSGEEDFESLASQFSDCSSAKARGDLGA
FSRGQMEKPFEDASFALRTGEMSGPVFTESGIHIILRTE
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcagacgagaagctgccgcccggctggaagaagtatatgagtcgcagctcaggccgg
gaatactacttcaatcacatcaccaacgccagccagtgggagcggcccagcgaaggcagc
agcaagaacggccagggtgagcctgccagggtgcgctgctcacacctgctggtgaagcac
agccaatctcggaggccctcatcctggcgccaggaaaagatcaccaggagcaaggaggag
gccctggagctcatcaatggctacatccggaagattaagtcaggagaggaggactttgaa
tctctggcctcacagttcagtgactgcagctctgccaaagccaggggagacctgggtgcc
ttcagcagaggacagatggagaaaccgtttgaggatgcatcgtttgctctacggactggg
gagatgagtgggcccgtgttcacggagtcaggcatccatatcatcctgcgcacagaatga

DBGET integrated database retrieval system