KEGG   Mus musculus (mouse): 26370
Entry
26370             CDS       T01002                                 

Gene name
Cetn2, 1110034A02Rik, AI326150, Calt, caltractin
Definition
(RefSeq) centrin 2
  KO
K10840  centrin-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    26370 (Cetn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    26370 (Cetn2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    26370 (Cetn2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    26370 (Cetn2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     26370 (Cetn2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    26370 (Cetn2)
   Centrosome duplication proteins
    Centriole replication proteins
     26370 (Cetn2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      26370 (Cetn2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_9 EF-hand_5 EF-hand_4 EF-hand_14 SurA_N_3 Dockerin_1 SUB1_ProdP9 RTP SPARC_Ca_bdg LETM1 DUF4601
Other DBs
NCBI-GeneID: 26370
NCBI-ProteinID: NP_062278
MGI: 1347085
Ensembl: ENSMUSG00000031347
Vega: OTTMUSG00000017845
UniProt: Q9R1K9
Position
X A7.3; X 37.29 cM
AA seq 172 aa
MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRAL
GFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcctctaattttaagaagacaaccatggcatccagtgcccagagaaaaaggatgagt
cctaagcctgaacttactgaagaccagaaacaggaaatccgggaagcttttgatctcttt
gatgctgatggaactggaactatagacatcaaagaactgaaggtggcaatgagggccctg
ggctttgagcccaagaaagaagaaattaagaaaatgataagtgaaattgataaagaagga
acaggaaaaatgaacttcagtgactttttgacagtgatgactcagaaaatgtctgagaaa
gacactaaagaagaaatcctgaaagctttcaagttgttcgatgatgatgagactgggaaa
atatcattcaagaatcttaagcgcgtggccaaggagctgggtgagaacctgacagatgag
gaactgcaggaaatgattgatgaagctgatcgagatggagatggtgaggtcaatgagcaa
gagttcctgcgcatcatgaaaaagaccagcctctattaa

DBGET integrated database retrieval system