KEGG   Mus musculus (mouse): 26397
Entry
26397             CDS       T01002                                 

Gene name
Map2k3, AW212142, MAPKK_3, MEK3, MKK3, MKK3b, Prkm, Prkmk3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04218  Cellular senescence
mmu04620  Toll-like receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26397 (Map2k3)
   04015 Rap1 signaling pathway
    26397 (Map2k3)
   04668 TNF signaling pathway
    26397 (Map2k3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    26397 (Map2k3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26397 (Map2k3)
   04664 Fc epsilon RI signaling pathway
    26397 (Map2k3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26397 (Map2k3)
   04935 Growth hormone synthesis, secretion and action
    26397 (Map2k3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26397 (Map2k3)
  09159 Environmental adaptation
   04714 Thermogenesis
    26397 (Map2k3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26397 (Map2k3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26397 (Map2k3)
   05161 Hepatitis B
    26397 (Map2k3)
   05169 Epstein-Barr virus infection
    26397 (Map2k3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26397 (Map2k3)
   05135 Yersinia infection
    26397 (Map2k3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26397 (Map2k3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    26397 (Map2k3)
   05022 Pathways of neurodegeneration - multiple diseases
    26397 (Map2k3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26397 (Map2k3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26397 (Map2k3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26397 (Map2k3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26397 (Map2k3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 26397
NCBI-ProteinID: NP_032954
MGI: 1346868
Ensembl: ENSMUSG00000018932
Vega: OTTMUSG00000006341
UniProt: O09110 Q5SWN9
Position
11; 11 B2
AA seq 347 aa
MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVD
FTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtcgcccgccgcgagcccgccggccagcttgcctcagaccaaaggaaaatccaaa
aggaaaaaggacttacggatatcctgcgtgtccaagccacctgtgtccaaccccacaccc
ccccggaacctggactcccggaccttcatcactatcggagacagaaacttcgaagtggag
gctgatgacttggtgaccatctcagagctgggtcgtggagcctatggggtggtagagaaa
gtgcggcatgctcagagtggtaccatcatggctgtcaagcgcatccgggccacagtgaac
acacaggagcagaaacgtctgcttatggacctagacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctatggtgccctcttcagagagggggatgtatggatctgcatg
gagctcatggacacttccctggataagttctaccggaaggtgctggagaagaacatgaaa
attccggaagacatcctgggggagatcgctgtgtctatcgtgcgggccctggagcacctg
catagcaagctgtctgtgatccacagagatgtgaagccatccaatgtcctcatcaacaag
gaagggcatgtgaagatgtgcgactttggcatcagtggctacctggtggactctgtggca
aagacaatggatgctggctgcaagccttacatggcccctgagaggatcaaccctgaactg
aatcagaagggctacaatgtcaagtctgatgtctggagcctcggcatcaccatgatcgag
atggccattctgcgattcccttatgagtcttggggcacaccgttccagcagctgaagcag
gtggtggaggagccatccccacagctcccagcggaccagttctcccctgagtttgtggac
ttcactagccagtgcctaaggaagaaccctgcagagcgcatgagctacctggagctgatg
gaacacccattcttcaccttgcacaaaactaagaagacagacattgctgcctttgtgaag
gagatcctgggagaggattcatag

DBGET integrated database retrieval system