KEGG   Mus musculus (mouse): 26440
Entry
26440             CDS       T01002                                 

Gene name
Psma1, C2, HC2, Pro, Pros-30, alpha-type
Definition
(RefSeq) proteasome subunit alpha 1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26440 (Psma1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26440 (Psma1)
   05012 Parkinson disease
    26440 (Psma1)
   05014 Amyotrophic lateral sclerosis
    26440 (Psma1)
   05016 Huntington disease
    26440 (Psma1)
   05017 Spinocerebellar ataxia
    26440 (Psma1)
   05020 Prion disease
    26440 (Psma1)
   05022 Pathways of neurodegeneration - multiple diseases
    26440 (Psma1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26440 (Psma1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26440 (Psma1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    26440 (Psma1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26440 (Psma1)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26440 (Psma1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26440 (Psma1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   26440 (Psma1)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26440
NCBI-ProteinID: NP_036095
MGI: 1347005
Ensembl: ENSMUSG00000030751
Vega: OTTMUSG00000025343
UniProt: Q9R1P4 Q3TS44
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
7 F1; 7 59.32 cM
AA seq 263 aa
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAAEEPAEKADEPMEH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttcgaaaccagtatgacaatgatgtcactgtttggagccctcagggcaggattcat
caaattgaatatgcaatggaagctgttaagcaaggttcagcaacagttggtctaaaatca
aaaacgcacgcagtgctggttgcactgaagagagcacagtcagagcttgccgctcaccag
aagaaaattctccatgttgacaaccatattggtatctcaattgcgggtctaactgctgat
gccagactgttatgcaactttatgcgccaggagtgtttggattccagatttgtgtttgac
agaccacttcctgtgtctcgtcttgtgtctctaattggaagcaaaacccagatcccaaca
cagcgatatggccggaggccgtatggtgttgggctgctcattgctggttatgatgatatg
ggccctcatattttccaaacctgtccatctgctaactattttgactgcagagctatgtct
attggagcccgttctcaatcagctcgtacttacctggagagacatatgtctgaatttatg
gagtgcaatttggatgaactggttaaacatggtctgcgtgccttaagagaaacactccct
gcagagcaggacctgaccacaaagaatgtttccattggaatcgttggtaaagacttggaa
tttacaatctacgatgatgatgatgtatctccattcctggatggtcttgaagaaagacca
cagagaaaagcacagccttcacaggctgctgaggaacctgcagaaaaagccgatgaacca
atggaacattaa

DBGET integrated database retrieval system