KEGG   Mus musculus (mouse): 26442
Entry
26442             CDS       T01002                                 

Gene name
Psma5, ZETA
Definition
(RefSeq) proteasome subunit alpha 5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26442 (Psma5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26442 (Psma5)
   05012 Parkinson disease
    26442 (Psma5)
   05014 Amyotrophic lateral sclerosis
    26442 (Psma5)
   05016 Huntington disease
    26442 (Psma5)
   05017 Spinocerebellar ataxia
    26442 (Psma5)
   05020 Prion disease
    26442 (Psma5)
   05022 Pathways of neurodegeneration - multiple diseases
    26442 (Psma5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26442 (Psma5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26442 (Psma5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26442 (Psma5)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26442 (Psma5)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26442 (Psma5)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26442
NCBI-ProteinID: NP_036097
MGI: 1347009
Ensembl: ENSMUSG00000068749
Vega: OTTMUSG00000007299
UniProt: Q9Z2U1 Q3UPK6
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
3; 3 F3
AA seq 241 aa
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttcctcactcggtccgagtacgacaggggtgtgaatactttttctcctgaaggaaga
ttatttcaagtggaatatgccattgaggctatcaagcttggttctacagccattggcatc
cagacctcagagggtgtatgtctagctgtggagaagagaattacctccccactaatggag
cctagcagcattgagaagattgtagagatcgatgctcatataggttgtgccatgagtggg
ctaattgctgatgctaaaactttaattgataaagccagagtggagacacagaaccactgg
ttcacctataatgagacaatgacagttgagagtgtgacccaggctgtgtccaatctggct
ctgcagtttggagaagaagatgcagatccaggtgctatgtctcgtccctttggagtagca
ttgttgtttggaggagttgatgagaaaggaccccaactgtttcacatggacccatctggg
acctttgtacagtgtgatgctcgagcaattggctctgcttctgagggtgcccagagctcc
ttgcaagaagtttaccataagtctatgactctgaaggaggccatcaagtcctcgctcatc
atcctcaagcaagtcatggaggagaagctgaatgcaaccaacatcgagctagccacggtg
cagcctggtcagaatttccacatgttcacaaaggaagaactggaggaggtgatcaaggac
atttaa

DBGET integrated database retrieval system