KEGG   Mus musculus (mouse): 26446
Entry
26446             CDS       T01002                                 

Gene name
Psmb3, AL033320, C10-, C10-II, D2Mgi4
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26446 (Psmb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26446 (Psmb3)
   05012 Parkinson disease
    26446 (Psmb3)
   05014 Amyotrophic lateral sclerosis
    26446 (Psmb3)
   05016 Huntington disease
    26446 (Psmb3)
   05017 Spinocerebellar ataxia
    26446 (Psmb3)
   05020 Prion disease
    26446 (Psmb3)
   05022 Pathways of neurodegeneration - multiple diseases
    26446 (Psmb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26446 (Psmb3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26446 (Psmb3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26446 (Psmb3)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26446 (Psmb3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    26446 (Psmb3)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 26446
NCBI-ProteinID: NP_036101
MGI: 1347014
Ensembl: ENSMUSG00000069744
Vega: OTTMUSG00000002743
UniProt: Q9R1P1 Q545G0
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
11 D; 11 61.07 cM
AA seq 205 aa
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHVIEKDKITTRTLKARMD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtctattatgtcctataatggaggggccgtcatggccatgaagggaaagaactgtgtg
gccatcgctgcagacagacgtttcgggatccaggcccagatggtgaccacggacttccag
aagatctttcccatgggtgacaggctctacataggcctggccggcctggccactgacgtc
cagacagttgcccagcgtctcaagttccgactgaacttgtatgagctgaaagaaggtcga
cagatcaagccttacaccctcatgagcatggtggccaacctcctgtatgagaagcggttc
ggtccctactacacagagcctgtcattgctggcctggacccgaagaccttcaagcccttc
atttgctctctggacctcattggctgtcccatggtgactgatgactttgtagtcagtggt
acctgctccgaacaaatgtatgggatgtgtgagtctctctgggagcccaacatggatcca
gaacacctgtttgaaaccatttctcaggccatgctgaacgcggtggaccgggatgccgtg
tcgggcatgggcgtcatcgtccacgtcattgagaaagacaagatcaccaccaggacgctg
aaggcccggatggactaa

DBGET integrated database retrieval system