KEGG   Mus musculus (mouse): 268860
Entry
268860            CDS       T01002                                 

Gene name
Abat, 9630038C02Rik, AI255750, GABA, Gabaat, Gabat, Gm9851, I54, Laibat, X61497
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu04727  GABAergic synapse
Module
mmu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    268860 (Abat)
   00650 Butanoate metabolism
    268860 (Abat)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    268860 (Abat)
   00280 Valine, leucine and isoleucine degradation
    268860 (Abat)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    268860 (Abat)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    268860 (Abat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    268860 (Abat)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     268860 (Abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     268860 (Abat)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class III
   268860 (Abat)
SSDB
Motif
Pfam: Aminotran_3 Tex_N Aminotran_1_2
Other DBs
NCBI-GeneID: 268860
NCBI-ProteinID: NP_766549
MGI: 2443582
Ensembl: ENSMUSG00000057880
Vega: OTTMUSG00000025937
UniProt: P61922
Position
16; 16 A1
AA seq 500 aa
MAFLLITRRLACSSQKNLHLFIPGSRYISQAAAKVDIEFDYDGPLMKTEVPGPRSKELMK
QLNTIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALAKLVQQPQ
NASTFINRPALGILPPENFVDKLQESLMSVAPRGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQRGFSKEELETCMVNQSPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFTTDNQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEEFRPSAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNVARVGKTLLTGLL
DLQAQYPQFISRVRGRGTFCSFDTPDEAIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLSIFSGILADFK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggccttcttgttgattacccgacggctggcctgcagttcccagaaaaacctccacctc
ttcatacctggatccagatatatcagccaagccgctgccaaagttgacattgaatttgat
tatgatggaccactcatgaagacggaagtcccggggcctagatctaaggaactaatgaaa
cagctgaacacaatccagaatgcagaggccgtgcactttttctgcaactatgaagagagc
agaggtaactacctagtggacgtggacggcaaccgcatgttggacctgtattctcagatc
tcctctgtgcccataggttacaaccatccggctctggcgaaactcgttcaacagcctcag
aacgcgagcactttcatcaacagacctgccttgggcatcctgcctccagagaactttgtg
gacaagctccaggagtccttgatgtcggtggcgcccaggggcatgtcccagctcatcacc
atggcctgtggctcctgctccaatgagaatgcattcaagaccatcttcatgtggtaccgg
agtaaggaacgagggcagagaggtttctccaaagaggagctggagacttgcatggttaac
cagagtcctggatgcccagactacagcattctctccttcatgggtgctttccatgggagg
accatgggttgcttagcgaccacacactccaaagcaattcacaagattgacatcccttcc
tttgactggcccattgctccattcccacggctgaaatatcccctggaggagtttacaacg
gacaaccagcaagaggaggcccgctgcctagaagaggtggaggatttaattgtgaaatat
cggaaaaagaagagaacggtggctggaatcatcgtggagcccatccagtccgagggtgga
gacaaccatgcatcagatgacttcttccggaagctgagagacatagccaggaagcatggc
tgtgccttcttggtggacgaggtgcagaccggaggaggctgtacaggcaagttctgggcc
catgaacactggggcttggatgacccagccgatgtgatgacgttcagcaagaaaatgatg
accgggggcttcttccacaaggaggagtttcggccaagtgctccttaccggattttcaat
acctggctgggggacccatccaagaacttgctgctggctgaggtcatcaacatcatcaag
cgggaagacctgctcaacaatgtggcccgtgtggggaagaccctactcacagggctgctg
gacctccaggcccagtaccctcagttcatcagcagagtgaggggacgaggcaccttctgt
tccttcgacactcccgatgaagccatacggaataaactcatcctaattgccaggaacaaa
ggtgtggtactggggggctgcggtgacaagtccatccgtttccgccccacgctggtcttc
agggatcaccacgcccatctgttcctcagcattttcagcggcatcttagcagacttcaag
taa

DBGET integrated database retrieval system