KEGG   Mus musculus (mouse): 319955
Entry
319955            CDS       T01002                                 

Gene name
Ercc6, 4732403I04, C130058G22Rik, CS, CSB
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 6
  KO
K10841  DNA excision repair protein ERCC-6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    319955 (Ercc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    319955 (Ercc6)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    319955 (Ercc6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    319955 (Ercc6)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      319955 (Ercc6)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII
Other DBs
NCBI-GeneID: 319955
NCBI-ProteinID: NP_001074690
MGI: 1100494
Ensembl: ENSMUSG00000054051
UniProt: F8VPZ5
Position
14; 14 B
AA seq 1481 aa
MFHEEVPNSTHPQEQDCLPSQHANAYKDMPVGQENGGVSEAGECLSSTSCEYGPSTSAEA
CVLAATRRGPTLLHIDRHQIPAVEPSAQALELQGLGVDVYDQAVLEQGVLQQVDSAMHEA
SCVAQLADAEKEYQSVLDDLMSCTTSLRQINKIIEQLSPQAASNRDINRKLDSVKRQKYN
KEQQLKKITAKQKRLQAILGGAGVQVELDHASLEEDDAEPGPSCLGSMLMPAQETAWEEL
IRTGQMTPFGTPAPQKQEKKPRKIMLNEASGFEKYLAEQAQLSFERKKQAATKRTAKKAI
VISESSRAAIETKADQRSQVLSQTDKRLKKHSRKLQRRALQFQGKVGLPSGKKPLEPEVR
PEAEGDTEGEESGSSPTDGEEEEEQEEEEGVASLSSDDVSYELKPLRKRQKYQKKVPVQE
IDDDFFPSSEEEDEAMEGRGGGRKVARRQDDGDEDYYKQRLRRWNRLRLQDKEKRLKLED
DSEESDAEFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTIQIIA
FLAGLSYSKIRTRGSNYRFEGLGPTIIVCPTTVMHQWVKEFHTWWPPFRVAVLHETGSYT
HKKERLIRDIVYCHGVLITSYSYIRLMQDDISRHDWHYVILDEGHKIRNPNAAVTLACKQ
FRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNASPVQV
KTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFIDSKA
VYRILNGENQIFSGLVALRKICNHPDLFSGGPKNASGPPEDELEEEQFGHWRRSGKMIVV
ESLLKIWHRQGQRVLLFSQSRQMLHILEVFLRAHKYSYLKMDGTTTIASRQPLITKYNED
TSIFVFLLTTRVGGLGVNLTGANRVIIYDPDWNPSTDTQARERAWRIGQKKQVTVYRLLT
AGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLTSPDASQGTETSAIFAG
TGSSIQTPKCQLKKRTSTVLGTDPKCKKPPVSDTPANAATLIGEKPKAAGATGRSVTSGE
SGPFKGDHDTNGNRASSVAFGEETDAGSTLEHLSVMSGDGKHSDSPTVDHTSRPPVEAST
SEKQGSSYAGARCQAQTEPVPMSEQMEGQFSKYKSKRKHDASEEETTEKRPQPKQKAKNS
KHCRDAKFEGTRVPHLVKKRRYRQQTSEQEGGAKDRSSDDYVLEKLFKKSVGVHSVVRHD
AIIDGSSPDYVLVEAEANRVAQDALKALRLSRQQCLGAASGVPTWTGHRGISGAPTGVKN
RFGQKRDSSLPVQHPSSLTEKTQNNMKKEGKAHTPEHFSGKEDGASVSGAPSSSSLLARM
RARNHMILPERLESDSEHLAEAAAVPPCGTEHDDLLVDMRNFIAFQAQVDGQASTQEILQ
EFESKLSVAQSCVFRELLRNLCNFHRTPGGEGIWKLKPEYC
NT seq 4446 nt   +upstreamnt  +downstreamnt
atgttccacgaggaagttcccaactccactcaccctcaggagcaagactgtttaccaagt
cagcatgccaatgcttacaaagacatgccagttgggcaggagaatggtggggtctcagag
gccggggagtgcctctcctctacttcctgtgagtatgggccatccacatctgctgaagct
tgtgtgttggcagccacaaggcgtgggccgaccctgctacacattgatcggcatcagatc
cctgcagttgagcccagtgctcaggccctggagctgcagggcctgggtgtggacgtctat
gaccaggctgtcctggaacaaggcgtgcttcagcaggtggacagtgcgatgcatgaggcc
agctgtgtggcccagcttgctgatgcggagaaggagtatcagtcagtcctggatgacctc
atgtcatgtacaacatccctgaggcaaatcaataaaattatagagcaacttagccctcaa
gctgccagcaacagagacatcaacaggaaactagattccgtgaagcgacagaagtataac
aaggaacaacagctaaagaagataactgcaaaacagaaacgtctccaggccattctcgga
ggggctggggtccaagtggaactggatcatgccagcctagaggaggacgatgcagagcca
gggccatcatgtcttggcagtatgctcatgcctgcccaggagaccgcctgggaggagctt
atccgcactggccagatgacaccgtttggtaccccagcccctcagaaacaggagaaaaag
cccagaaaaataatgctgaatgaagcatcaggctttgaaaaatatttggcagagcaagca
caactttcgtttgaaaggaagaaacaagctgctactaaaagaacagctaaaaaagctata
gtcatatccgagtcaagccgagcagcaattgaaaccaaggcagaccagagaagccaagtg
ctctctcagacagacaagcgcctgaagaagcacagcaggaaactccagaggagggcgctg
cagttccagggcaaagtgggattgccgagcgggaagaaacctttggagcctgaggtgagg
ccagaggccgagggagacactgagggtgaggagtctgggtcctctcccaccgatggggag
gaggaggaagaacaagaggaggaggaaggggtagccagcctgtcttctgatgacgttagc
tatgagctgaagcctcttcggaagaggcagaaataccagaagaaagtcccagttcaggag
atcgacgatgacttctttccaagttctgaggaggaagatgaagctatggaaggaagagga
ggaggccgaaaggtagccaggcgccaagacgatggagatgaggattattataagcagcgg
ttaaggaggtggaacaggctgaggctgcaggacaaagagaaacgcctgaagcttgaagat
gattctgaggagagcgatgccgaatttgacgaaggtttcaaagtgccgggttttctgttc
aaaaagctctttaagtatcagcagacaggtgttaggtggctgtgggaattgcactgccag
caggcaggaggaattctgggagacgaaatgggattgggcaagaccatccagataattgcc
ttcttggcaggtctgagctacagcaagatcaggactcgcggttcaaattacaggttcgag
ggactaggccccactataattgtctgcccaacgacagtgatgcatcagtgggtgaaggaa
ttccacacgtggtggcctccattcagagtggcagttctgcatgaaacaggttcctacacc
cacaaaaaggagaggctgattcgagatattgtttattgtcatggagttttgataacttca
tattcatacatccgactgatgcaagatgacattagcagacatgactggcactacgtcatc
ttagatgaaggacacaaaattcgaaatccaaatgctgcagtcacccttgcttgcaaacag
ttccggacacctcatcggattatcttgtctggctcaccgatgcagaataacctccgagag
ctgtggtcactcttcgacttcatcttcccaggaaagctgggcacattgcctgtgtttatg
gagcagttctctgtccccatcaccatgggaggctattccaatgcttccccagtacaggtt
aaaactgcttataagtgtgcatgtgtcttaagagacacgataaacccgtacttactgcgg
agaatgaaatcagatgtcaagatgagcctttcgttgccagataaaaatgagcaggtctta
ttttgccgtctaactgatgagcagcataaagtctaccagaatttcattgattctaaagca
gtctacaggattctcaatggagaaaatcagattttctctggacttgtagcgctgaggaag
atctgcaaccaccctgacctcttttctggcggccccaagaacgccagtggtcctccagag
gatgagctggaagaagagcagtttggacactggagacgctctgggaaaatgattgttgtt
gagtctttgctgaaaatatggcacaggcagggtcagcgggtgctgctgttttcccagtcc
aggcagatgctacacatactggaagtgttcctgagagcccataagtattcctatctcaag
atggatgggaccaccaccatagcgtcaagacagccgctgattacaaaatacaatgaggac
acgtccatctttgtctttcttctgaccacacgggtgggtggcttaggagtgaacctgacc
ggtgccaacagagtcatcatctacgacccagactggaatccaagcaccgacacacaggcc
cgggagcgagcatggaggataggtcagaagaagcaggtgactgtctacaggcttctgacg
gctggcaccattgaggaaaagatctaccaccgacaaatcttcaagcaatttttgacaaac
agagtgctaaaagacccaaaacaaaggcgctttttcaaatccaacgatctctatgagctg
ttcactctgaccagtcctgacgcctcccagggcactgagacaagtgctatttttgcagga
acgggctccagtattcagacacccaaatgccagttaaaaaaaaggacttccacagtcctg
ggaacagatcccaaatgcaagaagccccctgtttctgacacacctgcaaatgctgccacc
ctgattggagaaaaacctaaggcggcgggagctacaggaagaagtgtcacttctggagaa
agtggtcctttcaaaggcgaccatgacacaaatgggaacagagctagcagtgttgctttt
ggagaagagacagatgcagggtccacactggagcatctctcagtgatgagtggagatggg
aagcattcagattctccaacagttgaccacacatccaggccaccagtggaggcaagcacc
agtgagaagcagggttcttcctatgcaggggcgcgctgccaggctcagacagaacctgtt
cccatgagtgaacaaatggaaggtcagttttctaagtacaaatccaaaaggaagcatgat
gcatctgaggaagagaccacagagaaacgtccacagcccaagcaaaaggccaagaactcc
aagcattgcagagatgctaagtttgagggaactcgagtcccgcacctggtgaagaaaaga
cggtaccgccagcaaaccagtgagcaggagggcggagccaaggaccggagcagcgatgat
tatgtgttggaaaagcttttcaaaaaatcagtgggcgtgcacagcgtcgtgaggcatgat
gccatcatagatgggtccagtccagattatgtgctggtggaagcagaagccaaccgagtg
gctcaggacgccttgaaagctctgaggctctctcgtcagcaatgcctgggggcagcatct
ggtgttcccacctggactggccacagggggatttctggtgcaccaacaggagtaaagaat
aggttcggtcagaaaagggactccagcctccctgtgcagcatccttcatcactaacagaa
aagactcagaacaacatgaaaaaggagggaaaagctcacacccctgagcacttcagtggc
aaagaagatggagcatctgtgtctggagcgcccagttcctcctccctcttggccagaatg
cgagcaagaaaccacatgattttgccggagcgcttagagagtgacagtgaacatcttgct
gaggctgctgccgtgcctccctgcggcaccgaacacgacgaccttctggtggacatgagg
aacttcattgctttccaggcccaggtggatggccaggccagcactcaggaaatcctgcag
gagtttgagtccaagctgtccgtggcacagtcctgtgtcttccgagaactgctgagaaat
ctgtgcaatttccatagaactcctggtggggaagggatttggaagctgaagccagaatac
tgctaa

DBGET integrated database retrieval system