KEGG   Mus musculus (mouse): 327762
Entry
327762            CDS       T01002                                 

Gene name
Dna2, Dn, Dna2l, E130315B21Rik
Definition
(RefSeq) DNA replication helicase/nuclease 2
  KO
K10742  DNA replication ATP-dependent helicase Dna2 [EC:3.6.4.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    327762 (Dna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    327762 (Dna2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     327762 (Dna2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    327762 (Dna2)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     327762 (Dna2)
SSDB
Motif
Pfam: Dna2 AAA_12 AAA_11 AAA_30 AAA_19 PDDEXK_1 SRP54 bpMoxR AAA_25 cobW CbiA Helicase_RecD Cas_Cas4 DUF853 AAA_16 MobB YqeC AAA_29 AAA PhoH AAA_23 UvrD-helicase AAA_7 AAA_18 UvrD_C_2 AAA_33
Other DBs
NCBI-GeneID: 327762
NCBI-ProteinID: NP_796346
MGI: 2443732
Ensembl: ENSMUSG00000036875
Vega: OTTMUSG00000030825
UniProt: Q6ZQJ5
Structure
PDB: 
5EAN 5EAW 5EAX

Position
10; 10 B4
AA seq 1062 aa
MEPLDELDLLLLEEDGGAEAVPRVELLRKKADALFPETVLSRGVDNRYLVLAVETSQNER
GAEEKRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDCTSEPWIIDDDFGYFIL
YPDMMISGTSVASSIRCLRRAVLSETFRGSDPATRQMLIGTILHEVFQKAISESFAPERL
QELALQTLREVRHLKEMYRLNLSQDEILCEVEEYLPSFSKWAEDFMRKGPSSEFPQMQLS
LPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKMKYKVMPLEL
KTGKESNSIEHRSQVVLYTLLSQERREDPEAGWLLYLKTGQMYPVPANHLDKRELLKLRN
WLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQIGNCALYSRAVEEQGDDASIP
EAMLSKIQEETRHLQLAHLKYFSLWCLMLTLESQSKDNRKTHQSIWLTPASELEESGNCV
GNLVRTEPVSRVCDGQYLHNFQRKNGPMPATNLMAGDRIILSGEERKLFALSKGYVKKMN
KAAVTCLLDRNLSTLPATTVFRLDREERHGDISTPLGNLSKLMESTDPSKRLRELIIDFR
EPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKRVLLSKDYTLIVGMPGTGKTTTIC
ALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKVGFLRLGQSHKVHPDIQKFTEEEICR
SRSIASLAHLEELYNSHPIVATTCMGINHPIFSRKTFDFCIVDEASQISQPVCLGPLFFS
RRFVLVGDHQQLPPLVVNREARALGMSESLFKRLERNESAVVQLTVQYRMNRKIMSLSNK
LTYAGKLECGSDRVANAVLALPNLKDARLSLQLYADYSDSPWLAGVLEPDNPVCFLNTDK
VPAPEQVENGGVSNVTEARLIVFLTSTFIKAGCSPSDIGVIAPYRQQLRIISDLLARSSV
GMVEVNTVDKYQGRDKSLILVSFVRSNEDGTLGELLKDWRRLNVALTRAKHKLILLGSVS
SLKRFPPLGTLFDHLNAEQLILDLPSREHESLSHILGDCQRD
NT seq 3189 nt   +upstreamnt  +downstreamnt
atggagccgctggacgagctggacctgctgctgctggaagaggacggcggagcggaggcc
gtgccgcgggtggagctacttcggaagaaggcggacgctttgtttccagagacagttctg
agccgaggagtggataaccggtacctggtgctagctgttgagacctcgcagaatgaaaga
ggagccgaggagaagcgcttgcacgtcacggcgtcccaggaccgagagcacgaagttctg
tgcatcctgaggaatggctggagctcagtaccagttgagccaggggacatcgttcactta
gagggagactgcacatctgagccgtggataatagacgatgactttggatattttattctg
tacccggacatgatgatctccggcacaagcgtcgctagcagcattcggtgtctgagaaga
gctgtcctgagcgagaccttcaggggctctgatccagccactcgccagatgctgatcggt
acaattctccacgaagtctttcagaaagcgataagtgagagctttgctccagaaaggcta
caagagcttgctcttcagaccctccgagaagtgaggcatttgaaggaaatgtatcgcttg
aatctgagccaagatgaaatactctgtgaagttgaggagtatctcccttctttctctaag
tgggcggaggacttcatgcgtaagggcccttcgtctgaattccctcaaatgcagctctct
ctgccaagcgatggcagtaacagaagttcaccttgtaacattgaagtagtcaagtcactg
gatatcgaagaaagcatctggtcccctaggtttggactgaagggcaaaatagacgtcaca
gtcggggtcaaaatacatcgagattgtaaaatgaaatacaaggtaatgccactggagctg
aagaccggcaaagagtccaactccatcgagcaccggagtcaggtggtcctgtacacgctg
ctaagccaggagaggcgagaggaccccgaggctggctggcttctctacctcaagaccggg
cagatgtaccctgtgcccgccaaccatctggacaaaagagaactgctgaagctcaggaac
tggctggccgcctcgctgctgcaccgtgtgagccgagcagctccgggggaggaagctcgg
ctctctgccttgccacagataatcgaggaagagaaaacttgtaaatactgttcgcagata
ggcaactgtgctctttatagcagagcagttgaagagcagggagatgacgcatccatccca
gaagccatgctgtccaaaatccaggaagaaacacggcacctgcagctggcgcacttgaag
tatttcagcctgtggtgtctcatgttaacgctggagtcgcaatctaaagacaaccggaag
actcaccagagtatctggttaacgcctgcctctgaactggaggagagtggcaactgtgtt
ggaaacctggtcaggacggagcctgtatcaagagtttgtgatggacagtatttacataat
tttcagcggaaaaatggtcccatgccagccaccaatctgatggcaggtgacaggattatt
ttaagtggagaagagagaaaactatttgctttgtccaaaggctacgtgaagaagatgaac
aaggcagccgttacctgcttgctagacaggaacttgtcgacactcccagcaacaacggtg
tttcgattagaccgggaagaaagacatggcgacataagtactccactaggaaatctgtct
aaattgatggaaagcacagatcccagcaaaagacttcgagaattaatcatcgatttcagg
gaacctcagttcatcgcctacctcagctccgtccttccacacgatgcgaaggatacggtg
gccaacattctaaagggtttgaataaaccccagagacaagcaatgaagagagtccttctt
tcgaaagactacacgctcattgttgggatgccagggacaggaaagacaaccaccatctgt
gccctggtgaggatcctctctgcctgtgggttcagcgttctgctgaccagctacacgcac
tccgccgttgacaatattctcctgaagttagccaagtttaaagtcggatttttgcgcttg
ggtcagtctcataaggtccatccagacatccagaagtttacagaggaggagatttgcaga
tcgaggtccattgcgtctttagcccatctagaagaactctataacagtcaccctattgtt
gcaacaacctgcatgggaataaatcacccaatattttcccgaaaaacctttgatttctgt
attgtggatgaagcatctcaaatcagccagcccgtctgcctgggcccactgttcttttcg
cggaggtttgtgctggtgggggaccatcagcagctgcctcccctggttgtaaaccgagag
gcaagagctctgggcatgagcgagagcttgttcaagaggctggagcggaacgagagcgct
gtggtgcagctgaccgtgcaataccgaatgaacaggaagattatgtccctgagcaacaag
ctcacatacgcagggaaactggagtgtgggtcagaccgagtggccaacgcagtgctagcc
ctgcccaacctcaaggacgcaaggctgagcctccagctttatgccgactactctgacagc
ccctggctggctggagtgttagagccagacaatcccgtgtgtttccttaacacagacaag
gtcccagctccagagcaagttgaaaatggtggtgttagcaatgtcacagaagccagactc
attgtcttcctaacctcaacttttataaaggcaggctgcagcccctcagacattggcgtc
atcgccccgtaccgacagcagctgcggatcatcagcgacttactggcccggtcttctgtt
gggatggttgaggttaacacagtagacaaataccaaggaagggacaagagtctcatcctg
gtgtcctttgttaggagtaatgaggatggaactctcggcgagctcctgaaagattggcgg
agactcaacgtggcactcaccagagccaagcataaactgatcctgctgggcagcgtgtcc
tcgctgaagcgcttcccgcctctggggacgctctttgaccatctgaatgcagagcagtta
atcctggaccttccttccagagagcatgagagcctcagccacatcctgggcgattgtcag
cgagactga

DBGET integrated database retrieval system