KEGG   Mus musculus (mouse): 353371
Entry
353371            CDS       T01002                                 

Gene name
Oxct2b, Scot-, Scot-t2
Definition
(RefSeq) 3-oxoacid CoA transferase 2B
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    353371 (Oxct2b)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    353371 (Oxct2b)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    353371 (Oxct2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     353371 (Oxct2b)
SSDB
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Other DBs
NCBI-GeneID: 353371
NCBI-ProteinID: NP_862907
MGI: 2664115
Ensembl: ENSMUSG00000076438
Vega: OTTMUSG00000008932
UniProt: Q9ESL0 A0A0R4J198
Position
4; 4 D2.2
AA seq 520 aa
MAALRLLAWALPRGVSALRPRPALPHRLIRRYVSDRSGSVHFYTDPVKAVEGVKDGSTVM
LGGFGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRRVVCSYLGENA
LCEKLYLAGELELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTLVQEGGSPIRYAPDGHL
ITLSEPREVREFQGRFYLLEHAIRADFALIKGWKADRSGNVIFRGSARNFNVPMCKAADI
SVVEVEEIVDVGTFAPEDIHIPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDPSR
TRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKNEVDAD
VINAGKQTVTVVPGGCFFASDDSFAMIRGGHLQLTMLGAMQVSQYGDLANWMVPGKKVKG
MGGAMDLVSSKKTRVVVTMEHCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSK
GLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQQIKLDA
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggcgctgaggcttctggcctgggcgctcccacgtggggtctctgctctccgccca
cgacctgcgctgccccaccgccttatccgccgctatgtttcggaccgcagcgggagtgtc
catttctacacggacccggtgaaggcggtggagggcgtcaaggatgggtcgaccgtcatg
ctcgggggcttcgggctctgcggcatccccgagaacctgatcggtgcgctgaagaccaag
ggcgtgaaggacctgaagatcgtcagcagcaacgtgggcgtggacgacttcggcctgggc
atcttgctggcctccaagcaggtcaggcgcgtggtgtgctcctacctgggggagaacgcg
ctctgcgagaagctctacctggcgggcgagctggaactggagatgacgccgcagggaact
ctggccgagcgcatccgcgcgggtggcactggcgtgcccgccttctacacgcccacaggc
tacggaacgctggtgcaggaagggggctctccaatccggtacgcgcccgatggccacctg
attactctaagtgagccgcgagaagtacgcgagtttcagggccgcttctacctgctagag
cacgctatccgcgctgacttcgcactgatcaagggctggaaagccgaccgctcgggcaac
gtgatcttcagaggcagcgcgcgcaacttcaatgtgcccatgtgcaaggccgcggacatc
tcggtggtagaagtggaggagatcgtggacgttggtactttcgccccggaagacatccac
atccccaacatctatgtggaccgcgtgatcaaggggccgaagttcgagaagcgcatcgag
cgcctaaccacacgtgacagcaagcccgcgcccgggagcaaagacaatgacccttccagg
acgcgcatcatcaagcgcgcggctctggagttccaggacggcatgtatgccaatctgggc
atcgggatccctgtcttggcgagcaactacatcagccccaagatgaccgtctacctgcac
agtgaaaacggaatcctgggcttgggcccgttccctttgaaaaatgaggtagatgccgac
gtcatcaacgcaggcaagcagacagtgacggtggttcccgggggctgtttcttcgccagc
gatgactcttttgccatgattcgtggcggacacctccaactgaccatgcttggggccatg
caagtttctcaatacggcgacctggccaactggatggtgccaggcaagaaggtgaagggc
atgggtggggccatggacttggtgtctagtaaaaagaccagagtggtagtcaccatggaa
cactgtaccaagacaaagcagcccaaaatcttgaagaaatgcaccatgccgttgactggc
aagcgctgcgtggacctcatcatcactgagaaggcggtgtttgaagtgaaccactcaaag
gggctgacgctggtggagctgtgggagggctcgtcggtagatgacatcaaggccaccaca
gcctgttcatttgctgtgtcccccaacctcaagcccatgcagcagattaaacttgatgct
tga

KEGG   Mus musculus (mouse): 64059
Entry
64059             CDS       T01002                                 

Gene name
Oxct2a, Oxct, Oxct2, Scot, Scot-, Scot-t1
Definition
(RefSeq) 3-oxoacid CoA transferase 2A
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    64059 (Oxct2a)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    64059 (Oxct2a)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    64059 (Oxct2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     64059 (Oxct2a)
SSDB
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Other DBs
NCBI-GeneID: 64059
NCBI-ProteinID: NP_071316
MGI: 1891061
Ensembl: ENSMUSG00000076436
Vega: OTTMUSG00000008979
UniProt: Q9JJN4
Position
4; 4 D2.2
AA seq 520 aa
MAALRLLAWALPRGVSALRPPPALPHRLIRRYVSDRSGSVHFYTDPVKAVEGVKDGSTVM
LGGFGLCGIPENLIGALKTKGVKDLKIVSSNVGVDDFGLGILLASKQVRRVVCSYLGENA
LCEKLYLAGELELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTLVQEGGSPIRYAPDGHL
ITLSEPREVREFQGRFYLLEHAIRADFALIKGWKADRSGNVIFRGSARNFNVPMCKAADI
SVVEVEEIVDVGTFAPEDIHVPNIYVDRVIKGPKFEKRIERLTTRDSKPAPGSKDNDPSR
TRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKNEVDAD
VINAGKQTVTVVPGGCFFASDDSFAMIRGGHLQLTMLGAMQVSQYGDLANWMVPGKKVKG
MGGAMDLVSSKKTRVVVTMEHCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSK
GLTLVELWEGSSVDDIKATTACSFAVSPNLKPMQQIKLDA
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggcgctgaggcttctggcctgggcgctcccacgtggggtatctgctctccgccca
ccacccgcgctgccccaccgccttatccgccgctatgtttcggaccgcagcgggagtgtc
catttctacacggacccggtgaaggcggtggagggcgtcaaggacgggtctaccgtcatg
ctcgggggcttcgggctctgcggcatccccgagaacctgatcggtgcgctgaagaccaag
ggcgtgaaggacctgaagatcgtcagcagcaacgtgggcgtggacgacttcggcctgggc
atcttgctggcctccaagcaggtcaggcgcgtggtgtgctcctacctgggggagaacgcg
ctctgcgagaagctctacctggcgggcgagctggaactggagatgacgccgcagggaact
ttggccgagcgcatccgcgcgggtggcactggcgtgcccgccttctacacgcccacaggc
tatggaacgctggtgcaggaagggggctctccaatccggtacgcgcccgatggccacctg
attactctaagtgagccgcgagaagtacgcgagttccagggccgcttctacctgctagag
cacgctatccgcgctgacttcgcactgatcaagggctggaaggccgaccgctccggcaac
gtgatcttcaggggcagcgcgcgcaacttcaatgtgcccatgtgcaaggccgcggacatc
tcggtggtggaagtggaggagatcgtggacgtgggtactttcgccccggaagacatccac
gtccccaacatctatgtggaccgcgtgatcaaggggccgaagttcgagaagcgcatcgag
cgcctaaccacacgtgacagcaagcccgcgcccgggagcaaagacaatgacccttccagg
acgcgcatcatcaagcgcgcggctctggagttccaggacggcatgtatgccaatctgggc
atcgggatccctgtcttggcgagcaactacatcagccccaagatgaccgtctacctgcac
agtgaaaacggaatcctgggcttgggcccgttccctttgaaaaatgaggtagatgccgac
gtcatcaacgcaggcaagcagacagtgacggtggttcccgggggctgtttcttcgccagc
gatgactcttttgccatgatccgtggcggacacctccaactgaccatgcttggggccatg
caggtttctcaatacggcgacctggccaactggatggtgccaggcaagaaggtgaagggc
atgggcggggccatggacttggtgtctagtaaaaagaccagagttgtagtcaccatggaa
cactgcaccaagacaaagcagcccaaaatcttgaagaaatgcaccatgccattgaccggc
aagcgctgcgtggacctcatcatcactgagaaggcagtgtttgaagtgaaccactcaaag
gggctgacactggtggagctgtgggagggctcgtcggtagatgacatcaaggccaccaca
gcctgttcatttgccgtgtcccccaacctcaagcccatgcagcagattaaacttgatgct
tga

KEGG   Mus musculus (mouse): 67041
Entry
67041             CDS       T01002                                 

Gene name
Oxct1, 2610008O03Rik, Oxct, Oxct2a, Sco, Scot-s
Definition
(RefSeq) 3-oxoacid CoA transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00280  Valine, leucine and isoleucine degradation
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    67041 (Oxct1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    67041 (Oxct1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    67041 (Oxct1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     67041 (Oxct1)
SSDB
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Other DBs
NCBI-GeneID: 67041
NCBI-ProteinID: NP_077150
MGI: 1914291
Ensembl: ENSMUSG00000022186
Vega: OTTMUSG00000024748
UniProt: Q9D0K2
Position
15; 15 A1
AA seq 520 aa
MAALKLLSSGLRLGASARSSRGALHKGCVCYFSVSTRHHTKFYTDPVEAVKDIPNGATLL
VGGFGLCGIPENLIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGENA
EFERQFLSGELEVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSV
AIASKPREVREFNGQHFILEEAITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAGT
TVVEVEEIVDIGSFAPEDIHIPKIYVHRLIKGEKYEKRIERLSLRKEGDGKGKSGKPGGD
VRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNMTVHLQSENGVLGLGPYPLKDEAD
ADLINAGKETVTVLPGASFFSSDESFAMIRGGHVNLTMLGAMQVSKYGDLANWMIPGKMV
KGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKGVFDVDK
KNGLTLIELWEGLTVDDIKKSTGCDFAVSPNLMPMQQIST
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcggctctcaaactcctgtcctctgggcttcggctcggcgcctcagcccgcagctcg
cggggcgccctgcataaggggtgtgtctgctacttctctgtcagtactcgtcaccacacc
aaattttacacagatcccgtggaagctgtaaaagatattcctaatggtgcaaccttgctg
gttggtggttttgggctgtgtggtattccagagaatcttataggagctttactgaagact
ggagtaaaagatctaactgcagtcagcaacaatgcaggggttgacaacttcggcctgggc
cttttacttcgatccaagcagataaaacgaatgatctcctcatatgtgggagaaaatgca
gaatttgagcgacagttcctttctggtgaattagaagtagagctgacacctcagggcaca
cttgccgagaggatccgtgccggtggagctggagtccctgccttctacaccagcacaggg
tatgggactctggtacaggaaggaggatcacccatcaaatataacaaagatggcagtgtt
gccattgccagcaagccacgagaggtgagggagtttaacggtcagcacttcattttggag
gaagccatcacgggagattttgctctggtgaaagcatggaaagcagaccgggcaggcaat
gtgattttcaggaaaagtgcaagaaacttcaatctgccaatgtgcaaagctgcaggaact
accgtggtggaggttgaagaaattgtagacattggctcatttgccccagaagatatccac
attccaaagatttatgtgcaccgcctcataaagggagagaaatatgagaagagaattgag
cgtttatcactccgaaaggaaggagatggaaaaggcaaatccggtaagcctggaggcgat
gtgagggaacggatcatcaagcgagccgccctggagtttgaggacggcatgtacgctaac
ttgggtattgggattcctcttctggccagcaacttcatcagtcccaacatgactgttcat
cttcaaagtgaaaatggagtcttgggcctgggcccatacccactgaaagacgaagctgat
gcggatctcatcaatgcaggaaaggaaacagttactgttctcccaggagcctctttcttc
tccagcgatgagtcattcgccatgattagagggggacatgtcaatctaacaatgttagga
gccatgcaggtttctaagtatggtgacctggccaactggatgatacctggaaaaatggtg
aaaggaatgggaggagctatggatttggtgtccagttccaaaaccaaagtggtggtcacc
atggagcactctgcgaagggaaatgctcataaaatcatggagaaatgtacactaccactg
acgggcaaacagtgtgtcaaccgcatcattacagaaaagggtgtgtttgacgtggacaag
aaaaatggtttgacactgattgagctctgggaaggcctgactgttgatgacatcaagaag
agcacaggctgtgactttgcagtttcaccaaacctcatgccaatgcagcagatttcaact
tga

DBGET integrated database retrieval system