KEGG   Mus musculus (mouse): 50505
Entry
50505             CDS       T01002                                 

Gene name
Ercc4, AI606920, Xp, Xpf
Definition
(RefSeq) excision repair cross-complementing rodent repair deficiency, complementation group 4
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    50505 (Ercc4)
   03460 Fanconi anemia pathway
    50505 (Ercc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    50505 (Ercc4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    50505 (Ercc4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     50505 (Ercc4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     50505 (Ercc4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     50505 (Ercc4)
SSDB
Motif
Pfam: ERCC4 HHH_5
Other DBs
NCBI-GeneID: 50505
NCBI-ProteinID: NP_056584
MGI: 1354163
Ensembl: ENSMUSG00000022545
Vega: OTTMUSG00000024311
UniProt: Q9QZD4 Q3UEU6
Position
16; 16 A1
AA seq 917 aa
MEPGLSGERRSMAPLLEYERQQVLELLDSDGLVVCARGLGTDRLLYHFLRLHCHPACLVL
VLNTQPAEEEYFINQLKIEGVEHLPRRVTNEIASNSRYEVYTQGGIIFATSRILVVDFLT
GRIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVER
VMRNLFVRKLYLWPRFHVAVNSFLEQHKPEVVEIHVSMTPAMLAIQTAILDILNACLKEL
KCHNPSLEVEDLSLENALGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQ
YDCVTFLNLLESLRATEKVFGQNSGWLFLDASTSMFVNARARVYRVPDVKLNKKAKTSEK
TSSPEVQETKKELVLESNPKWEALTDVLKEIEAENKESEALGGPGRVLICASDDRTCCQL
RDYLSAGAETFLLRLYRKTFEKDGKAEEVWVNVRKGDGPKRTTKSDKRPKAAPNKERASA
KRGAPLKRKKQELTLTQVLGSAEEPPEDKALEEDLCRQTSSSPEGCGVEIKRESFDLNVS
SDAAYGILKEPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRASRP
GKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLARG
SAALDAPTDTRKAGGQEQNGTQSSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILT
PELCVERKSVSDLIGSLHSGRLYSQCLAMSRYYRRPVLLIEFDPSKPFSLAPRGAFFQEM
SSSDVSSKLTLLTLHFPRLRLLWCPSPHATAELFEELKQNKPQPDAATAMAITADSETLP
ESDRYNPGPQDFVLKMPGVNAKNCRSLMNQVKNIAELATLSLERLTTILGHSGNAKQLHD
FLHTAYADLVSKGRVRK
NT seq 2754 nt   +upstreamnt  +downstreamnt
atggagccaggcctgtcgggcgaacggcggagtatggcgccgctgttggagtacgagagg
cagcaggtgctggaactgctcgacagcgacgggctggtggtgtgtgcccgcggactcggc
accgaccggctcctctaccatttcctgcggcttcactgccacccggcctgcctggtgctg
gtgctcaacacgcagccggccgaggaggaatattttatcaatcagttgaagatagaagga
gttgaacatctccctcgacgagtgacaaatgaaatcgcaagtaacagtcgctatgaagtc
tacacgcagggtggtattatatttgcaacaagccgaatactcgtggttgatttcttgaca
ggtagaataccttcagatttaataactggcatcctcgtgtacagggcacacagaatcatt
gagtcctgccaggaagccttcatcctgcgcctcttccgccagaaaaacaagcgcgggttc
atcaaagctttcaccgacaacgctgttgcctttgacactggcttttgtcacgtggaaaga
gtgatgcggaacctttttgtgaggaagctctacctgtggccaaggttccatgtagcagtc
aactcattcttggaacaacacaagcctgaagttgtagagattcacgtgtccatgactccc
gccatgcttgccattcagacggccatactagacatcttaaatgcatgtctgaaagaactg
aaatgtcacaacccgtcacttgaagtagaagatttgtcactagaaaacgctcttgggaag
ccattcgacaagacaatccgccattacttggaccctttgtggcatcagcttggagccaag
actaaatccttggtgcaggatttaaagatactaagaaccttactgcagtatctctctcag
tatgattgtgttacatttctgaatcttctggaatctctgagagcaacagagaaggtgttt
ggtcagaattcaggttggcttttcctggatgctagcacctccatgtttgtgaatgctcgt
gcccgagtttaccgagttccagatgtcaaactgaacaaaaaggccaaaacatcagaaaag
acgtcgagtccagaagttcaagaaacaaaaaaagaactggttctagagagcaatccaaag
tgggaggcgctgactgacgtcctgaaagaaatcgaagcagaaaataaggagagcgaagcc
cttggtggcccaggccgggtgctgatctgtgcaagcgatgaccgcacgtgctgccagctg
agagactacctgtccgccggagcagaaaccttcctgctgcgactttataggaaaactttt
gagaaggatggcaaagctgaagaagtgtgggtaaatgttagaaagggggacggcccgaag
agaactacaaaatctgacaaaagaccaaaagccgctccaaacaaggagcgtgcttccgcc
aaaaggggggcccctctcaaaaggaagaagcaagagctgactctgacgcaagttttgggg
tccgctgaggagccgccggaggacaaggctttggaggaagacctgtgcagacagaccagt
agtagcccagaaggctgcggggtagagattaagcgtgaatcatttgatttaaatgtgtcg
tctgatgcggcctatggcatcctgaaagagcccctgaccatcatccatccgcttctaggg
tgcagcgacccctatgccctgacgcgggtactgcacgaggtggagcccagatacgtggtt
ctgtatgatgcagagctcacctttgttcgccaactggagatctacagggctagcaggcct
gggaaacctctgagggtttactttcttatatacggaggctccacggaagagcagcgctac
ctgactgctctgcggaaagaaaaggaagcctttgaaaagctcataagagaaaaagctagc
atggttgtccccgaagaacgggaaggcagagatgagaccaacctggacctagcaagaggc
tcagcagccctggatgctcccacggacactcggaaagccggtggccaggagcagaatggc
acccagtccagcatcgtggtggacatgcgtgagtttcggagcgagctcccatctctgatc
catcggcggggtattgacatagagccagtgactctggaggtgggtgattacatcctgaca
cctgagctgtgtgtggagcgcaaaagtgtgagcgacctcattggctcgctgcacagtggc
cgcctgtacagccagtgcctagccatgtctcgctactaccggaggcctgtgctgctcatt
gagtttgacccgagcaagcccttctccctggcgccacgaggtgccttcttccaggagatg
agcagcagcgatgtgagctccaagcttacgctcctcaccttgcacttcccgcgtttgcgg
ctgctctggtgcccctcaccccacgccacagccgagctgtttgaggagctgaagcagaac
aagccacagcctgatgcggccacagccatggccatcaccgcagactcagagacactgcct
gagtcggacagatataaccccggcccccaagactttgtgctgaagatgcctggggtcaac
gccaagaactgtcgctccctgatgaaccaagtgaagaacatcgcagagctggccaccctg
tccctggaacgactcacaaccatcctggggcactcgggaaatgccaagcagctgcacgac
ttcctgcacactgcctatgcagacttggtgtccaaaggcagagtgagaaagtga

DBGET integrated database retrieval system