KEGG   Mus musculus (mouse): 52815
Entry
52815             CDS       T01002                                 

Gene name
Ldhd, 4733401P21Rik, D8Bwg1320e, DLD
Definition
(RefSeq) lactate dehydrogenase D
  KO
K00102  D-lactate dehydrogenase (cytochrome) [EC:1.1.2.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    52815 (Ldhd)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.4  D-lactate dehydrogenase (cytochrome)
     52815 (Ldhd)
SSDB
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Other DBs
NCBI-GeneID: 52815
NCBI-ProteinID: NP_081846
MGI: 106428
Ensembl: ENSMUSG00000031958
Vega: OTTMUSG00000038174
UniProt: Q7TNG8
Position
8 E1; 8 57.98 cM
AA seq 484 aa
MAMLLRVATQRLSPWRSFCSRGSQGGLSQDFVEALKAVVGSPHVSTASAVREQHGHDESM
HRCQPPDAVVWPQNVDQVSRVASLCYNQGVPIIPFGTGTGVEGGVCAVQGGVCINLTHMD
QITELNTEDFSVVVEPGVTRKALNTHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRY
GTMRDNVINLEVVLPDGRLLHTAGRGRHYRKSAAGYNLTGLFVGSEGTLGIITSTTLRLH
PAPEATVAATCAFPSVQAAVDSTVQILQAAVPVARIEFLDDVMMDACNRHSKLNCPVAPT
LFLEFHGSQQTLAEQLQRTEAITQDNGGSHFSWAKEAEKRNELWAARHNAWYAALALSPG
SKAYSTDVCVPISRLPEILVETKEEIKASKLTGAIVGHVGDGNFHCILLVDPDDAEEQRR
VKAFAENLGRRALALGGTCTGEHGIGLGKRQLLQEEVGPVGVETMRQLKNTLDPRGLMNP
GKVL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggccatgctccttcgggtggccacccagaggctgtctccctggaggagtttctgctcc
agggggtcgcagggtggactcagccaggactttgtggaggctctgaaggcagttgtaggg
agcccccacgtgtccactgcttctgcagtcagagagcaacacgggcatgatgaatcgatg
cacaggtgtcaacctcctgatgctgtggtttggcctcagaatgtggaccaggtcagccga
gtggcaagcctgtgctacaatcaaggtgttcccatcatcccatttggcacaggcaccggt
gttgaggggggagtctgtgctgtgcagggtggagtgtgcatcaacctgacccatatggac
cagatcacggagctgaatacagaagacttctccgtggtggtggagcctggagtcacccgt
aaagctctcaatacccacctgcgtgacagtggcctttggtttcctgttgacccaggcgca
gatgcttctctgtgtggcatggcagccaccggggcctcgggcaccaatgctgtgcgctat
ggaaccatgcgggacaacgtgattaacctggaggtagtgctgcctgacggcaggctgctt
cacaccgcaggccggggccgccattacaggaagagtgcagctggctacaatctcacagga
ctctttgtgggctctgaggggaccctgggcatcattacatcaaccaccctgcgcctgcac
cctgcgccggaagcaacggtggctgccacctgtgcgttccccagtgttcaagcggctgtg
gacagcacagttcagatcctccaggctgcagtgcccgtggctcgcattgagttcctagat
gatgtcatgatggatgcctgcaacagacacagcaaacttaactgccccgtggcacccacg
cttttcctggagttccacggttcccagcagacactggcggaacagctgcagcgcacagag
gcaatcactcaggataatggtggctctcacttctcctgggccaaggaggccgaaaagcgc
aatgaactttgggcagcgcggcacaatgcttggtatgcagccttggccctgagtccagga
agtaaggcctattccacggacgtgtgtgtacccatctcccggctgccagagatcttggta
gagaccaaggaggagattaaagcttcaaaactcacaggagccatcgttgggcatgtgggt
gatggcaactttcactgcatcctcctggtcgacccagatgatgcagaggagcagaggagg
gtcaaggcctttgcagaaaatctgggcaggcgggccctggcactcggtgggacatgcact
ggagaacatggcatcggactgggcaagcgacagctgctccaagaggaagtgggccccgtg
ggcgtggagaccatgcggcagctcaaaaacacactggatccccgtggtctcatgaaccca
ggcaaagtgctatga

DBGET integrated database retrieval system