KEGG   Mus musculus (mouse): 56436
Entry
56436             CDS       T01002                                 

Gene name
Adrm1, 1110063P18Rik, 2510006J17Rik, AA408205, ARM, ARM-1, AU043535, Arm1, Gp11, Gp110, Rp, Rpn13
Definition
(RefSeq) adhesion regulating molecule 1
  KO
K06691  26S proteasome regulatory subunit N13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    56436 (Adrm1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    56436 (Adrm1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    56436 (Adrm1)
   05012 Parkinson disease
    56436 (Adrm1)
   05014 Amyotrophic lateral sclerosis
    56436 (Adrm1)
   05016 Huntington disease
    56436 (Adrm1)
   05017 Spinocerebellar ataxia
    56436 (Adrm1)
   05020 Prion disease
    56436 (Adrm1)
   05022 Pathways of neurodegeneration - multiple diseases
    56436 (Adrm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    56436 (Adrm1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     56436 (Adrm1)
SSDB
Motif
Pfam: RPN13_C Proteasom_Rpn13 ASXH GerD
Other DBs
NCBI-GeneID: 56436
NCBI-ProteinID: NP_062796
MGI: 1929289
Ensembl: ENSMUSG00000039041
Vega: OTTMUSG00000016265
UniProt: Q9JKV1
Structure
PDB: 
2R2Y 2Z59

Position
2; 2 H4
AA seq 407 aa
MTTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNECLNNPPMPGSLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSSTSSARATPAPSAPAAASAT
SPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgacgacttcaggcgctctgttcccaagcctggtgcccggctctcgggggtcttctacc
aaatatttggtggagttccgggcaggaaaaatgtcattaaaaggaactacggtcacccca
gataaacggaaaggtctcgtgtacatccagcagacggacgactcccttattcacttctgt
tggaaagacaggacctctgggaccgtggaggatgacttgattatctttcctgatgactgt
gagttcaagcgggtacctcagtgccccagtgggagggtctacgtgctcaagtttaaggca
gggtccaagcggctcttcttctggatgcaggagcccaagactgaccaagatgaggagcac
tgccggaaagtcaacgagtgtctgaacaacccccccatgcctgggtcactgggagcaagt
gggagtagtggccatgagctttcagcactgggcggtgagggtggcctgcagagcctgttg
gggaacatgagtcacagccagcttatgcagctcatcggaccagccggcctgggaggactg
ggtggacttggggccctcactgggccaggcctggccagcttgctggggagcagtggacct
ccagccagcagctcttcatccagctcccggagccagtcggcagccgtcaccccatcctcc
tccacctcttccgctcgcgccaccccagccccttctgccccagcagctgcctcggcaacc
agcccaagccccgcacccagctcaggtaatggaaccagcacagcagccagcccgacccag
cccatccagctgagcgacctccagagcattctggccactatgaacgtgccggcagggcca
ggaggcagccagcaagtggatctggcgagtgtgctgaccccagagatcatggctcccatc
cttgccaatgcagacgttcaggagcgcctgctgccctacctgccctctggggagtctctg
ccccagactgcagatgagatccagaacacattaacctcgccccagttccagcaggccctg
ggtatgttcagtgcggccttggcctcaggacagcttggccctctcatgtgccagttcggc
cttcctgcagaggctgttgaggccgccaacaaaggtgatgtggaagcatttgccaaagcc
atgcagaacaatgccaaatcggacccaaaggagggcgacacaaaagacaagaaagacgaa
gaagaagatatgagtctagactaa

DBGET integrated database retrieval system