KEGG   Mus musculus (mouse): 56716
Entry
56716             CDS       T01002                                 

Gene name
Mlst8, 0610033N12Rik, AA409454, AI505104, AI851821, Gb, Gbl, mLS
Definition
(RefSeq) MTOR associated protein, LST8 homolog (S. cerevisiae)
  KO
K08266  target of rapamycin complex subunit LST8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    56716 (Mlst8)
   04150 mTOR signaling pathway
    56716 (Mlst8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    56716 (Mlst8)
   04136 Autophagy - other
    56716 (Mlst8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    56716 (Mlst8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56716 (Mlst8)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    56716 (Mlst8)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 Hira DUF5854
Other DBs
NCBI-GeneID: 56716
NCBI-ProteinID: NP_001239392
MGI: 1929514
Ensembl: ENSMUSG00000024142
UniProt: Q9DCJ1
Position
17; 17 A3.3
AA seq 326 aa
MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAAA
GYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQ
CQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPESSITSAHIDP
DASYMAAVNSAGNCYVWNLTGGIGDDVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSA
DQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVE
TGEIKREYGGHQKAVVCLAFNDSVLG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaataccaccccaggcacagtgggcagtgaccctgtcatcttagcaactgcaggctat
gaccacacggtgcgcttttggcaggctcacagtggaatctgcactcgaacagtgcagcat
caggactctcaggtaaatgcattggagattactccggaccgaagcatgattgctgctgca
ggttaccaacatatccgcatgtatgatctcaactccaataaccccaaccccatcatcagt
tatgacggagtcagtaagaacattgcatcagtgggctttcacgaggatggtcgctggatg
tatacaggtggcgaggactgcacagctcgcatctgggacctcaggtcccggaacttgcag
tgtcagcgtatcttccaggtgaacgcacccattaattgcgtgtgtctgcatcccaaccag
gcagaactcattgtgggtgatcagagcggtgctatccacatctgggacctgaagacagac
cacaatgagcagctgattcccgagcctgagtcttccatcacgtctgctcacatcgaccca
gatgctagctacatggcagccgtcaatagtgccggaaactgctatgtctggaacctgaca
gggggcattggtgacgatgtgactcagctcatccctaagaccaagatcccagcccataca
cgctatgccctgcaatgccgcttcagccctgattccacgcttcttgccacctgttcagct
gaccagacatgtaaaatctggaggacatccaacttctccctgatgacagagcttagcatc
aagagtagtaaccctggagagtcatcccgtggctggatgtggggctgtgccttctcaggg
gattcccagtacattgtcacagcttcttctgacaacctagcccggctctggtgtgtagag
actggagaaatcaagagagagtatggtggccatcagaaagctgtcgtctgcttggccttc
aatgacagtgtgctgggttag

DBGET integrated database retrieval system