KEGG   Mus musculus (mouse): 58810
Entry
58810             CDS       T01002                                 

Gene name
Akr1a1, 2610201A18Rik, Akr, Akr1a4
Definition
(RefSeq) aldo-keto reductase family 1, member A1 (aldehyde reductase)
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00040  Pentose and glucuronate interconversions
mmu00053  Ascorbate and aldarate metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    58810 (Akr1a1)
   00040 Pentose and glucuronate interconversions
    58810 (Akr1a1)
   00053 Ascorbate and aldarate metabolism
    58810 (Akr1a1)
   00620 Pyruvate metabolism
    58810 (Akr1a1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    58810 (Akr1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    58810 (Akr1a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     58810 (Akr1a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   58810 (Akr1a1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 58810
NCBI-ProteinID: NP_067448
MGI: 1929955
Ensembl: ENSMUSG00000028692
Vega: OTTMUSG00000009532
UniProt: Q9JII6 Q540D7 Q80XJ7
Structure
PDB: 
4GAC

Position
4; 4 D1
AA seq 325 aa
MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEAL
KESVGSGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTVRYDSTHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRP
AVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEK
HGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIV
PMITVDGKRVPRDAGHPLYPFNDPY
NT seq 978 nt   +upstreamnt  +downstreamnt
atgacggcctccagtgtcctcctgcacactggacagaagatgcctctgattggtctgggg
acatggaagagtgagcctggtcaggtgaaagcagccattaaacatgcccttagcgcaggc
taccgccacattgattgtgcttctgtatatggcaatgaaactgagattggggaggccctg
aaggagagtgtggggtcaggcaaggcagtccctcgagaggagctgtttgtgacatccaag
ctgtggaatactaagcaccaccctgaggatgtagaacctgccctccggaagacactggct
gatctgcaactggagtatttggacctctatttgatgcactggccttatgcctttgagcgg
ggagacaatccctttcccaagaatgccgatggaactgtcagatatgactcaactcactat
aaagagacctggaaggctctggaggtactggtggcaaaggggctggtgaaagccctgggc
ttgtccaacttcaacagtcggcagattgatgatgtcctcagtgtggcctctgtgcgccca
gctgtcttgcaggtggaatgccatccatacctggctcagaatgagctcattgcccactgt
cacgcacggggcttggaggtgactgcttatagccccttgggttcctctgaccgtgcttgg
cgccatcctgatgagccagtcctgcttgaagaaccagtagtcttggcactagctgaaaaa
catggccgatctccagctcagatcttgcttagatggcaggttcagcggaaagtgatctgc
atccccaaaagcatcaatccttcccgcatccttcagaacattcaggtatttgatttcacc
tttagcccagaggagatgaaacaattagatgctctgaacaaaaattggcggtatattgtg
cccatgattacggtggatgggaagagggttcccagagatgctggacaccctctgtatccc
tttaatgacccatactga

DBGET integrated database retrieval system