KEGG   Mus musculus (mouse): 66204
Entry
66204             CDS       T01002                                 

Gene name
Acyp1, 1110039O14Rik, AI325944
Definition
(RefSeq) acylphosphatase 1, erythrocyte (common) type
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    66204 (Acyp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     66204 (Acyp1)
SSDB
Motif
Pfam: Acylphosphatase DUF2871
Other DBs
NCBI-GeneID: 66204
NCBI-ProteinID: NP_079697
MGI: 1913454
Ensembl: ENSMUSG00000008822
Vega: OTTMUSG00000027677
UniProt: P56376 Q4VAF0
Position
12; 12 D1
AA seq 99 aa
MAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDRGTVQGQLQGPVSKVR
FMQQWLETRGSPKSHIDRANFNNEKVIANLDYSDFQIVK
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcagaaggggacaccttggtctcagtggattacgaaatttttggaaaggttcaaggg
gtgtttttccgcaagtacactcaggctgagggtaaaaagctaggtttggtgggctgggtt
cagaacaccgaccggggcaccgtgcaagggcaactgcagggccccgtctccaaggtgcgc
ttcatgcagcagtggctggagaccagaggaagtcccaagtcgcacattgacagagcaaac
ttcaacaatgagaaagtcatcgcaaacttggattattcagacttccaaattgtaaaataa

KEGG   Mus musculus (mouse): 75572
Entry
75572             CDS       T01002                                 

Gene name
Acyp2, 2310004B09Rik
Definition
(RefSeq) acylphosphatase 2, muscle type
  KO
K01512  acylphosphatase [EC:3.6.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    75572 (Acyp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     75572 (Acyp2)
SSDB
Motif
Pfam: Acylphosphatase
Other DBs
NCBI-GeneID: 75572
NCBI-ProteinID: NP_083620
MGI: 1922822
Ensembl: ENSMUSG00000060923
Vega: OTTMUSG00000005346
UniProt: P56375
Position
11; 11 A4
AA seq 106 aa
MLLGRRLAAMTELLKSVDYEVFGTVQGVCFRMYTEGEAKKRGLVGWVKNTSKGTVTGQVQ
GPEEKVDAMKSWLSKVGSPSSRIDRADFSNEKTISKLEYSDFSIRY
NT seq 321 nt   +upstreamnt  +downstreamnt
atgctgctcgggagaaggctggccgccatgaccgagctgctcaagtctgtggactacgaa
gtgttcgggacagtgcaaggtgtttgcttcagaatgtacacagaaggagaagctaagaaa
cgaggtctggttggctgggtgaagaacacaagcaaaggcacagtgacaggtcaagttcaa
ggccccgaagaaaaggttgatgccatgaagtcctggctgagcaaggttgggagtcctagt
tctcgcatcgaccgggccgacttttctaacgaaaaaacaatctctaaattggaatactct
gattttagtattcgatattaa

DBGET integrated database retrieval system