KEGG   Mus musculus (mouse): 66467
Entry
66467             CDS       T01002                                 

Gene name
Gtf2h5, 2700017P07Rik, 2810432H05Rik, D17Wsu155, D17Wsu155e
Definition
(RefSeq) general transcription factor IIH, polypeptide 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    66467 (Gtf2h5)
  09124 Replication and repair
   03420 Nucleotide excision repair
    66467 (Gtf2h5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    66467 (Gtf2h5)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66467 (Gtf2h5)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     66467 (Gtf2h5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     66467 (Gtf2h5)
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 66467
NCBI-ProteinID: NP_852057
MGI: 107227
Ensembl: ENSMUSG00000034345
Vega: OTTMUSG00000024049
UniProt: Q8K2X8
Position
17 A1; 17 3.7 cM
AA seq 71 aa
MVNVLKGVLIECDPAMKQFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGEL
MDQNAFSLTQK
NT seq 216 nt   +upstreamnt  +downstreamnt
atggtcaacgtgctgaaaggggtgcttatagaatgtgaccctgccatgaagcagttcttg
ctgtacttggatgaggccaacgccttggggaagaagttcatcattcaggacattgatgac
acgcacgtcttcgtcattgccgagctggtcaacgtcctccaggagcgagtaggggaactg
atggaccagaatgccttttctcttacccagaagtga

DBGET integrated database retrieval system