KEGG   Mus musculus (mouse): 66537
Entry
66537             CDS       T01002                                 

Gene name
Pomp, 2510048O06Rik, Ump, Ump1
Definition
(RefSeq) proteasome maturation protein
  KO
K11599  proteasome maturation protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    66537 (Pomp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    66537 (Pomp)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    66537 (Pomp)
SSDB
Motif
Pfam: UMP1
Other DBs
NCBI-GeneID: 66537
NCBI-ProteinID: NP_079900
MGI: 1913787
Ensembl: ENSMUSG00000029649
Vega: OTTMUSG00000055798
UniProt: Q9CQT5
Position
5; 5 G3
AA seq 141 aa
MNARGLGSELKDSIPVAELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQD
KMNFSTLRNIQGLFAPLKLQMEFKAVQQVHRLPFLPSSNLSLDILRGNDETIGFEDILND
PSQSELMGEPHVMVEHKLGLL
NT seq 426 nt   +upstreamnt  +downstreamnt
atgaacgccagaggtcttgggtcggagctgaaggacagtattccagtcgcggagctctca
gccagcgggcctttcgagagtcacgatcttctccggaaagggttttcttgtgtgaaaaat
gaacttttgcccagtcaccctctcgagttatcagaaaaaaacttccagctcaaccaggac
aagatgaacttttccacgctgaggaacatccagggtctgtttgctcccctgaagttacag
atggaattcaaggcagtgcagcaggttcaccgtctcccgtttctcccgagctcaaacctc
tcactggatattttgaggggcaacgatgagaccattggttttgaggatattcttaatgat
ccatcacaaagtgaactgatgggtgagccccacgtgatggtggaacataagctgggcttg
ctgtaa

DBGET integrated database retrieval system