KEGG   Mus musculus (mouse): 66671
Entry
66671             CDS       T01002                                 

Gene name
Ccnh, 6330408H09Rik, AI661354, AV102684, AW538719
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    66671 (Ccnh)
  09124 Replication and repair
   03420 Nucleotide excision repair
    66671 (Ccnh)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    66671 (Ccnh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    66671 (Ccnh)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    66671 (Ccnh)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     66671 (Ccnh)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     66671 (Ccnh)
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 66671
NCBI-ProteinID: NP_075732
MGI: 1913921
Ensembl: ENSMUSG00000021548
Vega: OTTMUSG00000035504
UniProt: Q61458
Position
13; 13 C3
AA seq 323 aa
MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDD
DYVSKKPKQEEEEWTDDDLVDSL
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtatcacagcagcagccagaaacggcactggaccttcgctagcgaggagcagctggcg
cgcctgcgggcggacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggtt
cttccaaatgatccagtgtttctggagcctcatgaagaattgacactttgcaagtactat
gaaaaaagattattggaattctgttcagtgtttaaaccagctatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
cctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccccagtttgttggaaatcttcgagagagtcctcttggacaggagagggcactg
gaacagattttggaatatgaactactacttatacaacaacttaattttcaccttattgtc
cacaatccatacagaccatttgaaggcttcctcatcgatataaagactcggtaccccatg
ttggagaatccggagattctgaggaaaacagctgatgattttcttagtagaattgcattg
acagatgcttatcttttatacacaccttcacagattgccctgaccgccattttatcaagt
gcctctagagctggaattactatggaaagctacttatcagagagtctaatgctaaaagaa
aacagaacttgcctgtcacagttactggatataatgaaaagcatgagaaatctagtaaaa
aagtacgagccgcccaggtctgacgaggttgctgtcctgaaacagaagctggagcggtgt
cattcttctgaccttgcacttaatgcggttacgaagaagaggaaaggctatgaagatgat
gactatgtgtcaaagaaacccaaacaggaagaggaggaatggactgatgacgacctggta
gattctctctaa

DBGET integrated database retrieval system