KEGG   Mus musculus (mouse): 67664
Entry
67664             CDS       T01002                                 

Gene name
Rnf125, 4930553F04Rik, C730049O14, C730049O14Rik
Definition
(RefSeq) ring finger protein 125
  KO
K12170  E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    67664 (Rnf125)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67664 (Rnf125)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     67664 (Rnf125)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    67664 (Rnf125)
SSDB
Motif
Pfam: zf_C2HC_14 zf-Di19 Rad50_zn_hook
Other DBs
NCBI-GeneID: 67664
NCBI-ProteinID: NP_080577
MGI: 1914914
Ensembl: ENSMUSG00000033107
UniProt: Q9D9R0
Position
18; 18 A2
AA seq 140 aa
MKSEYQNCAECGTLVCLSDMRAHIRTCEKYIDKYGPLLELGDTTARCVCPFCQRELDEDC
LLDHCIIHHRSERRPVFCPLCHSRPDESPSTFNGSLIRHLQVSHTLFYDDFIDFDIIEEA
IIRRVLDRSLLEYVNQSNTT
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaagtcagaataccagaactgtgctgagtgtggaactctggtttgcctcagtgacatg
agggcgcacataaggacctgtgagaagtacatcgataaatatggcccgctgctagaactt
ggcgacaccacagcaagatgtgtatgtccattttgtcagcgggaactggatgaagactgc
ttgctggatcattgcattatccaccacagatcagaaaggaggcccgtgttctgtccactt
tgccattcacgacctgatgaaagcccaagtaccttcaatggcagtttaattagacatttg
caagtcagtcacactttgttttatgatgatttcatagattttgatataattgaggaagcc
attattcgcagagtgctagaccgctcacttcttgaatatgtgaatcagtcaaacaccaca
taa

DBGET integrated database retrieval system