KEGG   Mus musculus (mouse): 71991
Entry
71991             CDS       T01002                                 

Gene name
Ercc8, 2410022P04Rik, 2810431L23Rik, 4631412O06Rik, B130065P18Rik, C, Ckn, Ckn1, Csa
Definition
(RefSeq) excision repaiross-complementing rodent repair deficiency, complementation group 8
  KO
K10570  DNA excision repair protein ERCC-8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    71991 (Ercc8)
  09124 Replication and repair
   03420 Nucleotide excision repair
    71991 (Ercc8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    71991 (Ercc8)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    71991 (Ercc8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     71991 (Ercc8)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      71991 (Ercc8)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Cytochrom_D1
Other DBs
NCBI-GeneID: 71991
NCBI-ProteinID: NP_082318
MGI: 1919241
Ensembl: ENSMUSG00000021694
Vega: OTTMUSG00000030543
UniProt: Q8CFD5
Position
13; 13 D2.1
AA seq 397 aa
MLSFLSARQSGLEDPLRLRRAQSTRRVLGLELNKDRDVERIHGSGVNTLDIEPVEGRYML
SGGSDGVVVLYDLENASRQPHYTCKAVCSVGRSHPDVHKYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQAADVFNFEETVYSHHMSPAATKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRHDYILATASADSRVKLWDVRRASGCLLTLDQHNGKKSQAAESA
NTAHNGKVNGLCFTSDGLHLLTIGTDNRMRLWNSSSGDNTLVNYGKVCNDSRKGLQFAVS
CGCSSEFVFVPHGSTIAVYAVHSGERLAMLKGHYKSVDCCVFQPNFQELYSGSRDCNILA
WVPPSYEPVPDDDDEAPAKSQLNPAFADAWSSSDEDG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgttgagctttttgtccgctcgacagtcgggtttggaggaccctcttcgcttgcgtaga
gcgcagtccacacggagggtcctggggctggagttaaacaaagacagggatgtggaaaga
atccatggcagtggggttaacaccctcgacattgagcccgttgaaggaagatacatgttg
tcaggtggctccgatggcgtggttgtactctatgaccttgagaacgccagcagacagccc
cattacacatgtaaagcagtgtgttccgttggcagaagccatcccgatgttcacaaatac
agcgtggagactgttcagtggtatcctcatgacactggcatgttcacatccagctcattt
gataaaactctgaaagtgtgggatacaaacacattgcaggctgcagatgtgtttaatttt
gaggaaacagtttacagtcatcacatgtccccagcagccaccaagcactgtctggtagca
gttggaacaagaggacccaaggtacaactttgtgacttaaagtctggatcctgttctcac
attctacagggtcacagacaggaaatcttggcagtttcctggtcaccacgccatgactat
atcttggcaacagcaagtgctgacagtagagtaaaattatgggatgtgagaagagcgtca
ggatgcttgcttactcttgaccagcataatgggaaaaagtcacaagctgctgaatcagca
aacactgctcacaatgggaaagttaacggcttatgttttacaagtgacggccttcacctg
ctcaccattggcacagacaaccgaatgcgcctctggaatagctccagcggggacaacacc
ctggtgaactatgggaaggtgtgtaatgacagcaggaaagggctgcagttcgctgtctcc
tgtggctgcagctcagagtttgtgtttgttccccacggcagcaccatcgctgtgtacgca
gtccactcgggagagcggctcgccatgctcaagggacattacaaaagcgtcgactgctgt
gtgttccagcctaatttccaggaactttacagtggaagcagggactgcaatattcttgct
tgggtaccaccttcctatgagccagttcctgatgatgacgatgaagctccagccaaatcc
cagttaaacccagcattcgcggacgcctggagcagcagtgacgaggatgggtga

DBGET integrated database retrieval system