KEGG   Mus musculus (mouse): 73174
Entry
73174             CDS       T01002                                 

Gene name
Tbkbp1, 3110043L15Rik, ProSAPiP2, SINTBAD
Definition
(RefSeq) TBK1 binding protein 1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    73174 (Tbkbp1)
SSDB
Motif
Pfam: TBD Zn-C2H2_12 CT_C_D Seryl_tRNA_N
Other DBs
NCBI-GeneID: 73174
NCBI-ProteinID: NP_932768
MGI: 1920424
Ensembl: ENSMUSG00000038517
Vega: OTTMUSG00000002304
UniProt: A2A9T0 Z4YKN2
Position
11; 11 D
AA seq 610 aa
MESMFEDDISILTQEALGPSEVWLDGPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLITDFGEEHGFPLYELKDGSLLEVEKVSLQQRLNQFQHELQKS
KEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQICGLEKQLQQQQGLRDAAF
SSLSPPAVPASACPDLDLHYLALRGGPALGHGWPGPTSVSVSELERRRLEEALEAAQGEA
RGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSECDMAWVKRVGDDQVNLALAYTE
LTEELGRLRELSSLQGRILRTLLQEQARNAGQRHSPLSQRHSPAPACPSPSPPARPPPCA
PCQSPAAQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPSC
PAPQPRPPPPPGERTLAERVYAKPPSHHAKAGFQGRRSYSELAEGAAYAGASPAWLQAEA
ATLPKPRAYGGELYGRPLSPRRAFEGIRLRFEKQPSEEEEWAMPASPPSPEAGTIRCASF
CAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDDALIKH
IDSHLENSKI
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggagtccatgtttgaagatgacatcagcatcctgacccaagaggccttggggcccagt
gaggtgtggctggatggtcctggagacccgtccctgggaggggacatgtgttctgcctcc
cactttgccctcatcacagcctacggagacatcaaggaaaggctaggaggcctggagagg
gagaatgccaccctccgccgtcgcctcaaagtctatgagatcaagtatccgctgatcact
gattttggagaggagcatggcttccctctgtatgaactcaaggatggctccctgctggag
gtggagaaggtcagtctgcagcaacgactcaaccaattccaacacgagttgcagaagagt
aaggagcaggaggagcagctcggggagatgatccaggcttacgagaaactgtgcgtggag
aaaagcgacttggagacagagctgggggagatgcgggccctggtagagactcatctacgg
cagatctgtggtctggagaaacagctgcagcaacagcagggcctccgggacgcagctttc
tccagcctgagccccccagctgtccccgcctcagcctgtcctgacttggacctgcactat
ctggctctgagagggggacctgccttgggtcatggttggcctggccctacgagtgtaagt
gtgagcgagctggagaggaggcgcctggaagaggccctggaggctgcgcagggggaggct
cggggggctcagctccgggaggagcaactccaggcggaatgcgagagacttcagggagag
ctgaagcaactgcaggagacccgggcccaggatctggcctccaaccagtcggaatgtgac
atggcttgggtcaagagagttggggatgatcaggtgaacttggcgctggcctacacagaa
ctgacagaggagctgggtcggcttcgggagctgagttccctgcaggggaggatcttgagg
actttgctgcaggaacaggcccgcaacgcaggccaaaggcactcaccgctgtcgcaacgt
cactccccggcccctgcgtgcccctcaccctccccgcctgcccgaccgccgccctgtgcc
ccgtgccagtcccccgctgcacagcgccgttcgcccgtgcccccgtgcccttcgccccag
cagcgccgctcgcccgcctcgccgtcctgcccgtccccagtcccacagcgccgctcgccc
gtgccgccgtcgtgccagtcgcccagtcctcagcgccgctcgcctgtgccacccagctgc
ccggccccgcagccccggccgccgccaccaccgggggagaggacgctggccgagcgtgtc
tacgccaagccgcccagccaccacgccaaggccggcttccagggccgccgcagctactcg
gagctggcggagggggcggcctacgctggtgcctcccccgcctggctacaggccgaggct
gccacacttcccaagccccgcgcctatggcggcgagctctacggcaggccgctcagcccg
cgccgagcctttgagggcatccgcctgcgctttgagaagcagccatctgaagaagaggag
tgggctatgccggccagcccgcccagtcccgaagcgggcaccatccgctgcgcttcattc
tgtgcgggcttccccatcccagagtcgcctgcggccaccgcctatgcccacgctgagcac
gcacagtcctggccatccatcaacctactgatggagacggtgggctctgatatccgcagc
tgccccctctgccagctgggtttccctgttgggtacccagatgatgctctcatcaaacac
atagactcccaccttgagaacagcaagatctag

DBGET integrated database retrieval system