KEGG   Mus musculus (mouse): 74147
Entry
74147             CDS       T01002                                 

Gene name
Ehhadh, 1300002P22Rik, HD, L-P, L-PBE, LBFP, LBP, MF, MFE1, MFP, MFP-1, MFP1, PBFE
Definition
(RefSeq) enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04146  Peroxisome
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    74147 (Ehhadh)
   00650 Butanoate metabolism
    74147 (Ehhadh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    74147 (Ehhadh)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    74147 (Ehhadh)
   00310 Lysine degradation
    74147 (Ehhadh)
   00380 Tryptophan metabolism
    74147 (Ehhadh)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    74147 (Ehhadh)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    74147 (Ehhadh)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    74147 (Ehhadh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     74147 (Ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     74147 (Ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     74147 (Ehhadh)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 TrkA_N Peptidase_S49 2-Hacid_dh_C F420_oxidored ApbA Methyltransf_11 DUF6174
Other DBs
NCBI-GeneID: 74147
NCBI-ProteinID: NP_076226
MGI: 1277964
Ensembl: ENSMUSG00000022853
Vega: OTTMUSG00000033863
UniProt: Q9DBM2
Position
16; 16 B1
AA seq 718 aa
MAEYLRLPHSLAMIRLCNPPVNAISPTVITEVRNGLQKASLDHTVRAIVICGANDNFCAG
ADIHGFKSPTGLTLGSLVDEIQRYQKPVVAAIQGVALGGGLELALGCHYRIANAKARVGF
PEVMLGILPGARGTQLLPRVVGVPVALDLITSGRHISTDEALKLGILDVVVKSDPVEEAI
KFAQTVIGKPIEPRRILNKPVPSLPNMDSVFAEAIAKVRKQYPGRLAPETCVRSVQASVK
HPYEVAIKEEAKLFMYLRGSGQARALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGV
LGLGTMGRGIAISFARVGIPVVAVESDPKQLDTAKKIITSTLEKEASKSGQASAKPNLRF
SSSTKELSSVDLVIEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALDVDDIASSTDRP
QLVIGTHFFSPAHIMRLLEVIPSRYSSPTTIATVMSLSKRIGKIGVVVGNCYGFVGNRML
APYYNQGYFLIEEGSKPEDVDGVLEEFGFRMGPFRVSDLAGLDVGWKVRKGQGLTGPSLP
PGTPTRKRGNTRYSPIADMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSEFLSQYRE
THHIKQRSISKEEILERCLYSLINEAFRILEEGMAASPEHIDVIYLHGYGWPRHVGGPMY
YAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHSSKL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggctgagtatctgaggctgccccactccctggctatgatccgcctctgcaatccaccg
gtcaatgccatcagtccaactgtaatcacagaagtaaggaatggactccagaaagctagt
ttggaccatacggttagagccatagtgatctgtggagcaaatgacaacttctgtgcaggt
gctgatatccatggctttaaatctcccactggccttacattaggaagcttggtagatgaa
atacagcgataccagaagccagtggtggccgccatccaaggcgtggctcttggaggagga
ctagagctggccttgggctgtcactatcggattgccaatgcaaaggctcgtgttggcttc
ccggaagtgatgctgggaattcttcctggtgcaagaggaacgcagcttctacccagggtc
gttggagttcctgttgctcttgacttaattacctcaggaagacatatttcaacagatgaa
gcactcaagcttggaattctggatgtagttgtaaagtcagacccagttgaagaagccatc
aaatttgctcagacggttataggtaaacccatagaaccccgcaggatcctaaacaagcca
gtcccaagcttgcccaacatggacagtgtttttgcagaagccattgccaaggtacggaag
cagtaccctggccgcctggctccggagacttgtgtccgttcagtccaggcctccgtgaag
catccatatgaagtggccatcaaggaagaagcaaagctgtttatgtaccttcgggggtcg
gggcaggctagagccctgcagtacgccttttttgctgaaaagtctgcaaataagtggtca
actccctcaggagcatcttggaaaacagcatctgctcaacccgtctcctcggttggtgtt
cttggcttgggaacgatgggccgaggcatcgccatctcttttgcaagggtggggatccct
gtggttgctgtagagtcagacccaaagcagctagatactgcaaagaagataataacttcc
accttggaaaaggaagcatcgaagagtggccaagcttcagcaaaaccaaacctcaggttc
tcctcatccacaaaggagctttcgagtgtggatttagtgattgaagcagtgttcgaagat
atgaacctgaagaagaaggtcttcgctgaactgtcagccctgtgcaagccgggagccttt
ctgtgcaccaatacctcagcactggatgtggatgacattgcttcttccacagatcgcccc
cagctggtgattggcacccacttcttctccccagcccacatcatgaggttactagaggtc
attcctagccgatactcttcccccactaccatcgccacagtcatgagcttatccaaaagg
attggaaagattggagtcgttgttggtaactgctatggatttgttgggaatcgaatgttg
gctccctattacaaccagggctatttcttgatagaggaaggtagtaagccagaggatgta
gatggggtcttagaagagtttggttttagaatgggacccttcagggtgtctgacctcgca
gggctagatgtgggttggaaagttcgcaaagggcaaggccttactggaccgtccttacct
ccaggaacccccacccgaaagaggggcaataccaggtactccccaattgctgatatgctc
tgtgaagctgggcgatttggtcagaagacaggtaagggctggtatcagtatgacaagcca
ctgggtcgcatccacaaacctgatccctggctttctgagtttctgtcacagtatagagaa
acccatcacatcaagcagcgctccatcagcaaggaggaaatcctggagcgttgcttatat
tcccttatcaacgaggcattccgcatcttggaggaggggatggccgctagcccagagcac
attgatgtcatctacttgcatgggtatgggtggccaaggcacgtgggtgggcccatgtac
tatgctgcctcagttgggctgcccacagttctagagaaattgcagaaatattacagacag
aatcctgacatcccccagctggagcccagtgactacctgaggaggctggttgcccaggga
agccctcctctgaaagaatggcaaagcttggcaggaccccatagcagcaaactgtga

KEGG   Mus musculus (mouse): 93747
Entry
93747             CDS       T01002                                 

Gene name
Echs1, C80529, SCEH
Definition
(RefSeq) enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01212  Fatty acid metabolism
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00085  Fatty acid elongation in mitochondria
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    93747 (Echs1)
   00650 Butanoate metabolism
    93747 (Echs1)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    93747 (Echs1)
   00071 Fatty acid degradation
    93747 (Echs1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    93747 (Echs1)
   00310 Lysine degradation
    93747 (Echs1)
   00380 Tryptophan metabolism
    93747 (Echs1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    93747 (Echs1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     93747 (Echs1)
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-GeneID: 93747
NCBI-ProteinID: NP_444349
MGI: 2136460
Ensembl: ENSMUSG00000025465
Vega: OTTMUSG00000027297
UniProt: Q8BH95
Position
7; 7 F4
AA seq 290 aa
MAALRALLPRACSSLLSSVRCPELRRFASGANFQYIITEKKGKNSSVGLIQLNRPKALNA
LCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHW
DHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLT
RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMA
KESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcggccctgcgtgctctgctgcccagagcctgtagctcactgttgtcctcagtccgc
tgcccagaactacggcgcttcgcctcgggtgctaactttcagtacatcatcacagaaaag
aaaggaaagaatagcagcgtggggctgatccagttgaaccgccccaaagcactcaatgca
ctttgcaatggcctgattgaggagctcaaccaagcactggagacctttgagcaagatcct
gctgtgggtgccattgtgctcactggtggggataaggcctttgcagctggagctgacatc
aaggaaatgcagaaccgaacatttcaggactgttactccagcaagttcctgagccactgg
gaccacatcacccgggtcaagaaaccggtcatcgcagctgtcaatggttatgctcttggt
gggggttgtgaacttgccatgatgtgtgatatcatctatgctggcgagaaagcccagttc
ggacagccagaaatcctcctggggaccatcccaggtgctggaggcactcagagactcacc
cgagcagtcggcaaatcgctagcaatggagatggtcctcactggtgaccgcatctcagct
caggatgcaaagcaggcaggtcttgtaagcaagatttttcctgttgaaaaactggttgaa
gaagccatccaatgtgcagaaaaaattgccagcaattctaaaatcgtagtagccatggcg
aaagaatctgtgaatgcagcctttgagatgacgttaacagaaggaaataagctggagaag
aggcttttctattccacctttgccaccgatgaccggagagaagggatgactgcatttgta
gagaaaaggaaggccaacttcaaagaccactga

KEGG   Mus musculus (mouse): 97212
Entry
97212             CDS       T01002                                 

Gene name
Hadha, C77020, Mt, Mtpa, TP-alpha
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit alpha
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Module
mmu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mmu_M00085  Fatty acid elongation in mitochondria
mmu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    97212 (Hadha)
   00650 Butanoate metabolism
    97212 (Hadha)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    97212 (Hadha)
   00071 Fatty acid degradation
    97212 (Hadha)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    97212 (Hadha)
   00310 Lysine degradation
    97212 (Hadha)
   00380 Tryptophan metabolism
    97212 (Hadha)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    97212 (Hadha)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     97212 (Hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     97212 (Hadha)
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Other DBs
NCBI-GeneID: 97212
NCBI-ProteinID: NP_849209
MGI: 2135593
Ensembl: ENSMUSG00000025745
Vega: OTTMUSG00000024740
UniProt: Q8BMS1
Position
5; 5 B1
AA seq 763 aa
MVASRAIGSLSRFSAFRILRSRGCICRSFTTSSALLTRTHINYGVKGDVAVIRINSPNSK
VNTLNKEVQSEFIEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLSSCTTPQEATRIS
QEGQRMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGVPEVLLGILP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGIKSPEERTIEYL
EEVAVNFAKGLADRKVSAKQSKGLVEKLTTYAMTVPFVRQQVYKTVEEKVKKQTKGLYPA
PLKIIDAVKAGLEQGSDAGYLAESQKFGELALTKESKALMGLYNGQVLCKKNKFGAPQKN
VQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALP
INQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVK
DGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVA
EDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLR
LPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggtggcgtcccgggcgattggcagtctcagtcgcttctctgccttcaggatcctacgc
tccagaggctgcatttgccgcagctttacaacgtcttctgctctgctgaccagaacccat
attaattatggcgtcaaaggggatgtggcagttattcggattaactcacccaattcaaag
gtaaatacattgaataaagaagtacagtcagagttcatagaagtcatgaacgaaatctgg
gccaacgaccaaatcaggagtgctgtccttatctcatcaaagcctggctgctttgtcgca
ggggctgacatcaacatgctatcctcttgtacaaccccccaagaagcaacacgaatatca
caggaaggtcagagaatgtttgagaaacttgaaaagtccccaaagcccgttgtggccgcc
atcagtggatcctgcttgggaggaggacttgagcttgccatagcatgccaatacagaata
gcaacaaaagacagaaaaacagtattaggtgtccctgaagtgttgctggggatcttacca
ggagccggaggtacccagagactgcccaaaatggtgggtgtgcctgctgcatttgacatg
atgctgactggcaggaacattcgtgcagacagagcaaagaaaatgggactggttgaccag
ttggtggaaccgctgggaccaggaataaaatcaccagaagaaaggacaattgaataccta
gaggaagttgcagttaattttgccaaaggcctggctgatcggaaagtctctgcaaagcag
agcaaaggccttgtggaaaagctgacaacgtatgccatgactgtcccatttgtcagacaa
caggtttacaaaacagttgaagaaaaagtgaagaagcagactaaaggcctttatcctgcc
cctttgaaaataattgatgctgtgaaggctggacttgagcaaggcagtgacgctggttat
cttgctgaatcgcagaaatttggagagcttgcattgaccaaagaatcgaaggccctgatg
gggctttataacggccaggtcctgtgcaagaaaaataaatttggagcaccacagaagaac
gttcagcagctagccatccttggcgcagggctgatgggggctggcattgcccaggtctct
gtggataagggactgaaaactcttcttaaagacaccacagtgacggggctgggccgggga
cagcagcaagtgttcaaagggctgaacgacaaagtgaagaagaaagctctcacatcattt
gaaagggattccatcttcagcaacttgattgggcagctggattacaaaggctttgagaag
gccgacatggtgattgaggctgtgtttgaggacctcggtgtaaagcacaaagtgttaaag
gaagtggaaagcgtgactccagaacactgtatctttgccagcaacacatctgctctccca
atcaatcaaattgctgctgtcagcaaaaggcctgagaaggtgatcggcatgcactacttc
tcccccgtggacaagatgcagctcctagaaatcatcaccactgacaaaacctccaaggac
acaacggcctctgccgtggccgtggggctcaggcaagggaaggtcatcattgtggtcaag
gacggacccggcttctacaccaccaggtgtcttgcacccatgatgtctgaagtcatgcga
atcctccaggaaggagttgaccctaagaagctggacgccttgaccacaggtttcggcttc
cctgtgggtgctgccacgctggcagacgaagtgggtgtggatgtagcacagcacgtagca
gaagatctaggcaaagcctttggggagcgatttggaggtggcagcgtagaactgctgaaa
cagatggtctccaagggcttcttaggtcgcaagtctgggaagggcttttacatctatcag
gagggctcaaagaataagagtttgaattctgaaatggataatatcttggcaaatctgagg
ctgcctgccaagcccgaggtctcctctgatgaagacgtccaataccgtgtgataacaagg
ttcgtgaacgaggcagtcctgtgcctacaggaagggatcctggccacaccggcagaggga
gacatcggagctgtctttgggcttggctttcccccttgtctcggagggcccttccgcttt
gtggatctgtatggtgctcagaaggtagtggaccggctacggaagtacgagtctgcctat
ggaacacagtttaccccatgccagctgctcctcgaccacgctaacaactctagcaagaag
ttctaccagtga

DBGET integrated database retrieval system