KEGG   Mus musculus (mouse): 74156
Entry
74156             CDS       T01002                                 

Gene name
Acot12, 1300004O04Rik, 4930449F15Rik, AV027244, Cac, Cach, mCACH-1
Definition
(RefSeq) acyl-CoA thioesterase 12
  KO
K01067  acetyl-CoA hydrolase [EC:3.1.2.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    74156 (Acot12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.1  acetyl-CoA hydrolase
     74156 (Acot12)
SSDB
Motif
Pfam: 4HBT START
Other DBs
NCBI-GeneID: 74156
NCBI-ProteinID: NP_083066
MGI: 1921406
Ensembl: ENSMUSG00000021620
Vega: OTTMUSG00000024121
UniProt: Q9DBK0 A2RSC2
Position
13; 13 C3
AA seq 556 aa
MESMVAPGEVLMSQAIQPAHADSRGELSAGQLLKWMDTTACLAAEKHAGISCVTASMDDI
LFEDTARIGQIITIRAKVTRAFSTSMEISIKVIVQDKFTGIQKLLCVAFSTFVAKPVGKE
KVHLKPVLLQTEQEQVEHNLASERRKVRLQHENTFNNIMKESSRFSDSICNEEEGTATTM
GTSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCHGHPFLKSVDMFKFRGPS
TVGDRLVFSAIVNNTFQNSVEVGVRVEAFDCQEWAEGQGRHINSAFLIYNAVDDQEKLIT
FPRIQPISKDDFRRYQGAIARRRIRLGRKYVISHKKEVPLSAQWDISKKGSLSNTNVEAL
KNLASKSGWEITTTLEKIKIYTLEEQDAISVKVEKLVGSPAHIAYHLLSDLTKRPLWDPH
YISCEVIDQVSEDDQIYYITCSVVNGDKPKDFVVLVSRRKPLKDNNTYTVALRSVVLPSV
PSSPQYIRSEVICAGFLIQAVDSNSCTVTYLNQMSDSILPYFAGNIGGWSKSIEEAAASC
IKFIENATPDGLKSVL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggagtcgatggtggcgccgggtgaggtgctcatgagccaggccatccagccggctcat
gccgactcccgcggcgagctgagcgcagggcagctgctcaagtggatggacaccaccgct
tgcctggcggccgaaaagcatgctgggatttcctgtgtcacagcctccatggatgacatt
ctgtttgaggacacagcgagaattggacaaattattaccatcagagcaaaagtgactagg
gcgttcagcacaagcatggagatcagtatcaaggtcatagtccaggacaagttcacgggc
atccagaagctcctctgcgtggctttctctacgtttgtagctaaaccagttggcaaagaa
aaggttcacttaaaacctgtcctgcttcaaacagagcaagaacaagtggagcacaatctg
gcttcagagagaaggaaagtccgactgcagcatgagaacaccttcaacaacattatgaag
gagagcagcaggttcagcgattccatttgtaatgaagaagaaggaacggccaccaccatg
ggcacctctgtccagagcatcgagcttgtccttccgccccacgcaaaccatcacggaaac
acatttggtggccagatcatggcatggatggagacagtcgccaccatttctgcaagccgc
ctgtgtcatgggcatccctttctgaagtctgtggatatgtttaaattccggggaccgtcc
acagttggagaccgccttgtcttcagtgccatagtcaacaacacctttcagaacagtgtg
gaagtcggagtgcgtgttgaggcctttgactgtcaggagtgggccgagggccaaggccgc
cacatcaacagcgcttttctcatttacaatgctgttgatgaccaggagaaactcatcacc
tttcccagaatccaacccatttcaaaggacgattttcgccgttaccagggagccatcgca
cggaggagaattcgcctaggcaggaaatatgttatttcccacaagaaagaagttccactc
agtgcacagtgggatataagcaaaaagggatccctaagtaacaccaatgtggaagctctc
aaaaatctggcatccaaaagcggttgggagattaccaccaccttggagaagataaaaata
tataccctggaggagcaagatgccatatctgttaaggttgaaaagcttgtgggcagtcca
gcccacatagcttatcatctcttgtctgacctcacaaagcgacctttatgggacccccat
tacatatcttgtgaagttatagaccaggtgagcgaggacgatcagatatattacatcact
tgctcggtggtaaatggagacaaacccaaggactttgtggtgcttgtgtcacgaagaaag
cccctcaaagacaacaacacctacaccgtggcactaaggtcagttgtgctgccgtctgtc
ccgtcatctccacagtacatcagaagtgaggtcatttgtgctgggtttctcatccaggct
gtcgacagcaattcgtgcaccgtaacgtacctgaaccagatgtcagacagcatcctccct
tactttgctggcaatattggtggctggtcaaaatccattgaggaagctgcagcctcttgt
ataaaattcatagagaatgctactcctgatggacttaaaagtgtgttataa

DBGET integrated database retrieval system