KEGG   Mus musculus (mouse): 74338
Entry
74338             CDS       T01002                                 

Symbol
Slc6a19, 4632401C08Rik, B<0>AT, B<0>AT1
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter), member 19
  KO
K05334  solute carrier family 6 (neurotransmitter transporter) member 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    74338 (Slc6a19)
   04978 Mineral absorption
    74338 (Slc6a19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    74338 (Slc6a19)
   04147 Exosome [BR:mmu04147]
    74338 (Slc6a19)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   74338 (Slc6a19)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   74338 (Slc6a19)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 74338
NCBI-ProteinID: NP_083154
MGI: 1921588
Ensembl: ENSMUSG00000021565
Vega: OTTMUSG00000026285
UniProt: Q9D687 Q3KN89
Position
13; 13 C1
AA seq 634 aa
MVRLVLPNPGLEERIPSLDELEVIEKEEAGSRPKWDNKAQYMLTCVGFCVGLGNVWRFPY
LCQSHGGGAFMIPFLILLVFEGIPLLYLEFAIGQRLRKGSMGVWSSIHPALKGIGIASMF
VSFMVGLYYNTIIAWVMWYFFNSFQEPLPWSECPLNQNQTGYVEECAKSSSVDYFWYRET
LNISTSISDSGSIQWWILLCLTCAWSVLYVCIIRGIETTGKAVYITSTLPYVVLTIFLIR
GLTLKGATNGIVFLFTPNITELSNPNTWLDAGAQVFYSFSLAFGGLISFSSYNSVHNNCE
MDSVIVSVINGFTSVYAATVVYSIIGFRATERFDDCVNTNILTLINGFDLPEGNVTSENF
EAYQQWCNATNPQAYAQLKFQTCDINSFLSEGVEGTGLAFIVFTEAITKMPVSPLWSVLF
FIMLFCLGLSSMFGNMEGVVVPLQDLNITPKKWPKELLTGLICLGTYLIAFIFTLNSGQY
WLSLLDSFAGSIPLLIIAFCEMFAVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPL
IMLVIFLFFFVIEVNKTLMYSIWDPNYEEFPKSQKIPYPNWVYAVVVTVAGVPCLSIPCF
AIYKFIRNCCQKSDDHHGLVNTLSTASVNGDLKN
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggtgaggcttgtgctgcccaaccctggcctagaggagcggattccatctctggatgag
ttagaggtcattgaaaaggaagaggccggctccaggcccaaatgggacaacaaggcccag
tacatgctcacctgtgtgggcttttgtgtggggctgggcaacgtgtggcgcttcccctac
ctatgccagagccatggaggaggggccttcatgatcccattcctcatccttctggtgttc
gagggaattcctttgctgtacctggagtttgccatcggtcagaggctacgcaagggcagc
atgggtgtgtggagctccatccaccctgctctgaagggtataggcatcgcctccatgttc
gtgtccttcatggtgggcctgtactacaacaccatcatcgcctgggtcatgtggtacttc
ttcaactcctttcaggaacctctgccatggagtgaatgtccactcaaccagaaccagaca
ggctatgtggaagagtgtgccaagagctcttccgtggactacttctggtaccgagagact
cttaatatctccacttccatcagtgactcaggctccatccagtggtggatcctgctctgc
ctgacatgtgcctggagtgtgctgtatgtgtgtattatccgtggcatcgagaccactggg
aaggctgtgtacatcacctccaccctgccctatgttgtactgaccatctttctcatccgt
ggcttgactctgaagggtgccaccaacggcattgtcttccttttcacacccaatatcaca
gagctgagcaaccccaacacgtggctggatgcaggtgctcaggtcttctactccttctca
ctggccttcgggggcctcatctccttctccagctacaactctgtgcacaataattgtgag
atggattctgtgatcgtgtctgtcatcaatggcttcacatctgtgtatgcggccaccgtg
gtctactccatcattggcttccgagccactgagcgctttgatgactgtgtcaacacgaac
atcctgaccctcatcaatgggttcgacctgccggagggcaatgtgacttcagagaacttt
gaggcctaccaacagtggtgcaatgccactaatccccaggcctatgcacaactgaagttt
cagacctgtgacattaacagcttcctttctgagggtgtggagggcacaggcctggccttc
attgtcttcacggaagccatcacgaagatgccagtgtccccactgtggtcggtgctcttt
tttataatgctcttctgcctgggactctcctccatgtttgggaacatggagggtgtggtc
gtaccccttcaggacctcaatatcacccctaagaagtggcccaaagaattgttgacaggc
ctcatctgcttggggacatatctcatcgccttcattttcacactgaattcgggccagtac
tggctctctctcctggacagctttgctggctccattcctctgctaatcatcgccttttgt
gagatgtttgccgtcgtctacgtgtatggagttgacaggttcaacaaggacatcgagttc
atgatcggccataagcccaacatcttctggcaagtcacgtggagagtggtcagtccactg
atcatgctggtcatcttcctcttcttttttgtgattgaggtcaacaaaacgctcatgtat
agcatctgggaccctaactatgaggagttcccgaaatctcagaagattccataccccaac
tgggtgtatgcagttgtggtcactgtggctggagtaccctgcctctccatcccctgcttt
gccatctacaagttcatcagaaattgttgtcagaagtctgatgaccaccatgggctggtc
aatacactgtccacagcctctgtgaatggggaccttaagaactga

DBGET integrated database retrieval system