KEGG   Microcebus murinus (gray mouse lemur): 105868331
Entry
105868331         CDS       T07238                                 

Name
(RefSeq) cytochrome P450 3A4
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
mmur  Microcebus murinus (gray mouse lemur)
Pathway
mmur00140  Steroid hormone biosynthesis
mmur00591  Linoleic acid metabolism
mmur00830  Retinol metabolism
mmur00980  Metabolism of xenobiotics by cytochrome P450
mmur00982  Drug metabolism - cytochrome P450
mmur00983  Drug metabolism - other enzymes
mmur01100  Metabolic pathways
mmur04976  Bile secretion
mmur05204  Chemical carcinogenesis - DNA adducts
mmur05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    105868331
   00591 Linoleic acid metabolism
    105868331
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    105868331
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105868331
   00982 Drug metabolism - cytochrome P450
    105868331
   00983 Drug metabolism - other enzymes
    105868331
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    105868331
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    105868331
   05207 Chemical carcinogenesis - receptor activation
    105868331
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmur00199]
    105868331
Enzymes [BR:mmur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     105868331
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     105868331
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     105868331
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     105868331
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     105868331
    1.14.14.-  
     105868331
Cytochrome P450 [BR:mmur00199]
 Cytochrome P450, animal type
  CYP3 family
   105868331
SSDB
Motif
Pfam: p450 Coa1 DUF3687
Other DBs
NCBI-GeneID: 105868331
NCBI-ProteinID: XP_012614508
VGNC: 82058
Position
17
AA seq 503 aa
MDLIPDFALETWFLLATSLVLLYLYGTHSHGLFKKLGIPGPTPLPIVGNVLSYGKGFWKF
DDECYKKYGDMWGLYDGRRPVLAITDPDMIKTVLVKECYSVFTNRRAFGPVGFMKSAISI
SEDEEWKRIRALLSPTFTSGKLKEMFPIISQYADVLVRNLKQEAEKGKMVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVEKTKKLLKFDFLDPFFLIITLFPFFTPIFEALNVSV
FPKDVTNFFKNSVKRMKESRLQDKQKHRVDFLQLMIDSQNSKETQSHKVLSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDATLPNKTPATYDALVQMEYLDMVV
NETLRLFPIAGRIERVCKKDVEIKGVFIPKGVVVMVPTYALHRDSKYWPEPEEFRPERFS
KKNKENIDPYIYLPFGNGPRNCIGMRFALMNMKLALVKILQNFSFKPCKETQIPLKLSPK
PLLQPEKPIVLKVEPRDGTMSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggacctcatcccagactttgccctggaaacctggtttctcctggctaccagcctggtg
ctcctctacctatatgggactcattcacatggactttttaagaagctagggattcctggg
cccacacctttgcctattgtgggaaatgttctgtcttacggcaagggattttggaaattt
gatgacgaatgttacaaaaagtatggggacatgtgggggttgtatgatggtcgaaggcct
gtgctggctatcacggatcccgacatgatcaaaacagtgctagtgaaagagtgttattct
gtcttcacaaaccggcgggcttttggtccagtgggatttatgaaaagtgccatctctata
tctgaagatgaagaatggaagagaatacgagcgttgctgtctccaaccttcaccagcgga
aaactgaaggagatgttccccatcataagccagtatgcagatgtgttggtgagaaacctg
aagcaggaagcagagaaaggcaagatggtcaccttgaaagacatctttggggcctacagc
atggatgtcatcacgggcacatcatttggagtgaacatcgattccctcaacaacccacaa
gatccctttgtggaaaagaccaagaagcttttaaaatttgatttcttagatccattcttt
ctcataataacactctttccattttttaccccaatttttgaagcattgaatgtttctgtg
tttccaaaagatgttacaaacttttttaaaaactctgtaaaaaggatgaaagaaagtcgc
ctccaagataaacaaaagcaccgagtagatttccttcagctgatgatcgactcccagaat
tcaaaagaaactcagtcccataaagttctgtctgatctggagctcgtagcccagtcaatt
atcttcatttttgctggctatgagaccactagcagtgttctttccttcattatgtatgaa
ctggccactcaccctgacgtccagcagaaactgcaggaggaaattgatgcgactttgcca
aataagacacctgccacctatgatgccctggtacagatggagtatcttgacatggtggtg
aatgaaactctcagattattccccattgccggaagaattgagagagtctgtaagaaagac
gttgaaatcaagggagtgttcattcccaaaggggtagtcgtgatggtaccaacgtatgcc
cttcaccgagactcaaagtactggccagagcctgaggagttccgccctgaaaggttcagc
aagaagaacaaggaaaacatagatccttacatatacctgccctttggaaatgggccccga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctcgtcaaaatactc
cagaacttctccttcaaaccttgcaaagaaacacagatccccttgaaattaagcccaaag
ccacttcttcaaccagaaaaacctattgttctcaaggttgagccaagagatgggaccatg
agtggagcctga

DBGET integrated database retrieval system