KEGG   Myotis myotis (greater mouse-eared bat): 118675217
Entry
118675217         CDS       T07220                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mmyo  Myotis myotis (greater mouse-eared bat)
Pathway
mmyo01521  EGFR tyrosine kinase inhibitor resistance
mmyo01522  Endocrine resistance
mmyo01524  Platinum drug resistance
mmyo04012  ErbB signaling pathway
mmyo04014  Ras signaling pathway
mmyo04015  Rap1 signaling pathway
mmyo04024  cAMP signaling pathway
mmyo04062  Chemokine signaling pathway
mmyo04066  HIF-1 signaling pathway
mmyo04068  FoxO signaling pathway
mmyo04070  Phosphatidylinositol signaling system
mmyo04071  Sphingolipid signaling pathway
mmyo04072  Phospholipase D signaling pathway
mmyo04081  Hormone signaling
mmyo04140  Autophagy - animal
mmyo04145  Phagocytosis
mmyo04150  mTOR signaling pathway
mmyo04151  PI3K-Akt signaling pathway
mmyo04152  AMPK signaling pathway
mmyo04210  Apoptosis
mmyo04211  Longevity regulating pathway
mmyo04213  Longevity regulating pathway - multiple species
mmyo04218  Cellular senescence
mmyo04360  Axon guidance
mmyo04370  VEGF signaling pathway
mmyo04380  Osteoclast differentiation
mmyo04510  Focal adhesion
mmyo04517  IgSF CAM signaling
mmyo04518  Integrin signaling
mmyo04550  Signaling pathways regulating pluripotency of stem cells
mmyo04611  Platelet activation
mmyo04613  Neutrophil extracellular trap formation
mmyo04620  Toll-like receptor signaling pathway
mmyo04625  C-type lectin receptor signaling pathway
mmyo04630  JAK-STAT signaling pathway
mmyo04650  Natural killer cell mediated cytotoxicity
mmyo04660  T cell receptor signaling pathway
mmyo04662  B cell receptor signaling pathway
mmyo04664  Fc epsilon RI signaling pathway
mmyo04666  Fc gamma R-mediated phagosome formation
mmyo04668  TNF signaling pathway
mmyo04670  Leukocyte transendothelial migration
mmyo04722  Neurotrophin signaling pathway
mmyo04725  Cholinergic synapse
mmyo04750  Inflammatory mediator regulation of TRP channels
mmyo04810  Regulation of actin cytoskeleton
mmyo04910  Insulin signaling pathway
mmyo04914  Progesterone-mediated oocyte maturation
mmyo04915  Estrogen signaling pathway
mmyo04917  Prolactin signaling pathway
mmyo04919  Thyroid hormone signaling pathway
mmyo04923  Regulation of lipolysis in adipocytes
mmyo04926  Relaxin signaling pathway
mmyo04929  GnRH secretion
mmyo04930  Type II diabetes mellitus
mmyo04931  Insulin resistance
mmyo04932  Non-alcoholic fatty liver disease
mmyo04933  AGE-RAGE signaling pathway in diabetic complications
mmyo04935  Growth hormone synthesis, secretion and action
mmyo04960  Aldosterone-regulated sodium reabsorption
mmyo04973  Carbohydrate digestion and absorption
mmyo05010  Alzheimer disease
mmyo05017  Spinocerebellar ataxia
mmyo05020  Prion disease
mmyo05100  Bacterial invasion of epithelial cells
mmyo05135  Yersinia infection
mmyo05142  Chagas disease
mmyo05146  Amoebiasis
mmyo05160  Hepatitis C
mmyo05161  Hepatitis B
mmyo05162  Measles
mmyo05163  Human cytomegalovirus infection
mmyo05164  Influenza A
mmyo05165  Human papillomavirus infection
mmyo05166  Human T-cell leukemia virus 1 infection
mmyo05167  Kaposi sarcoma-associated herpesvirus infection
mmyo05168  Herpes simplex virus 1 infection
mmyo05169  Epstein-Barr virus infection
mmyo05170  Human immunodeficiency virus 1 infection
mmyo05171  Coronavirus disease
mmyo05200  Pathways in cancer
mmyo05203  Viral carcinogenesis
mmyo05205  Proteoglycans in cancer
mmyo05206  MicroRNAs in cancer
mmyo05207  Chemical carcinogenesis - receptor activation
mmyo05208  Chemical carcinogenesis - reactive oxygen species
mmyo05210  Colorectal cancer
mmyo05211  Renal cell carcinoma
mmyo05212  Pancreatic cancer
mmyo05213  Endometrial cancer
mmyo05214  Glioma
mmyo05215  Prostate cancer
mmyo05218  Melanoma
mmyo05220  Chronic myeloid leukemia
mmyo05221  Acute myeloid leukemia
mmyo05222  Small cell lung cancer
mmyo05223  Non-small cell lung cancer
mmyo05224  Breast cancer
mmyo05225  Hepatocellular carcinoma
mmyo05226  Gastric cancer
mmyo05230  Central carbon metabolism in cancer
mmyo05231  Choline metabolism in cancer
mmyo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmyo05415  Diabetic cardiomyopathy
mmyo05417  Lipid and atherosclerosis
mmyo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmyo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    118675217
   04014 Ras signaling pathway
    118675217
   04015 Rap1 signaling pathway
    118675217
   04370 VEGF signaling pathway
    118675217
   04630 JAK-STAT signaling pathway
    118675217
   04668 TNF signaling pathway
    118675217
   04066 HIF-1 signaling pathway
    118675217
   04068 FoxO signaling pathway
    118675217
   04070 Phosphatidylinositol signaling system
    118675217
   04072 Phospholipase D signaling pathway
    118675217
   04071 Sphingolipid signaling pathway
    118675217
   04024 cAMP signaling pathway
    118675217
   04151 PI3K-Akt signaling pathway
    118675217
   04152 AMPK signaling pathway
    118675217
   04150 mTOR signaling pathway
    118675217
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    118675217
   04517 IgSF CAM signaling
    118675217
   04518 Integrin signaling
    118675217
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagocytosis
    118675217
   04140 Autophagy - animal
    118675217
  09143 Cell growth and death
   04210 Apoptosis
    118675217
   04218 Cellular senescence
    118675217
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    118675217
   04550 Signaling pathways regulating pluripotency of stem cells
    118675217
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118675217
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    118675217
   04613 Neutrophil extracellular trap formation
    118675217
   04620 Toll-like receptor signaling pathway
    118675217
   04625 C-type lectin receptor signaling pathway
    118675217
   04650 Natural killer cell mediated cytotoxicity
    118675217
   04660 T cell receptor signaling pathway
    118675217
   04662 B cell receptor signaling pathway
    118675217
   04664 Fc epsilon RI signaling pathway
    118675217
   04666 Fc gamma R-mediated phagosome formation
    118675217
   04670 Leukocyte transendothelial migration
    118675217
   04062 Chemokine signaling pathway
    118675217
  09152 Endocrine system
   04910 Insulin signaling pathway
    118675217
   04923 Regulation of lipolysis in adipocytes
    118675217
   04929 GnRH secretion
    118675217
   04915 Estrogen signaling pathway
    118675217
   04914 Progesterone-mediated oocyte maturation
    118675217
   04917 Prolactin signaling pathway
    118675217
   04926 Relaxin signaling pathway
    118675217
   04935 Growth hormone synthesis, secretion and action
    118675217
   04919 Thyroid hormone signaling pathway
    118675217
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    118675217
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    118675217
  09156 Nervous system
   04725 Cholinergic synapse
    118675217
   04722 Neurotrophin signaling pathway
    118675217
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    118675217
  09158 Development and regeneration
   04360 Axon guidance
    118675217
   04380 Osteoclast differentiation
    118675217
  09149 Aging
   04211 Longevity regulating pathway
    118675217
   04213 Longevity regulating pathway - multiple species
    118675217
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118675217
   05206 MicroRNAs in cancer
    118675217
   05205 Proteoglycans in cancer
    118675217
   05207 Chemical carcinogenesis - receptor activation
    118675217
   05208 Chemical carcinogenesis - reactive oxygen species
    118675217
   05203 Viral carcinogenesis
    118675217
   05230 Central carbon metabolism in cancer
    118675217
   05231 Choline metabolism in cancer
    118675217
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    118675217
  09162 Cancer: specific types
   05210 Colorectal cancer
    118675217
   05212 Pancreatic cancer
    118675217
   05225 Hepatocellular carcinoma
    118675217
   05226 Gastric cancer
    118675217
   05214 Glioma
    118675217
   05221 Acute myeloid leukemia
    118675217
   05220 Chronic myeloid leukemia
    118675217
   05218 Melanoma
    118675217
   05211 Renal cell carcinoma
    118675217
   05215 Prostate cancer
    118675217
   05213 Endometrial cancer
    118675217
   05224 Breast cancer
    118675217
   05222 Small cell lung cancer
    118675217
   05223 Non-small cell lung cancer
    118675217
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    118675217
   05170 Human immunodeficiency virus 1 infection
    118675217
   05161 Hepatitis B
    118675217
   05160 Hepatitis C
    118675217
   05171 Coronavirus disease
    118675217
   05164 Influenza A
    118675217
   05162 Measles
    118675217
   05168 Herpes simplex virus 1 infection
    118675217
   05163 Human cytomegalovirus infection
    118675217
   05167 Kaposi sarcoma-associated herpesvirus infection
    118675217
   05169 Epstein-Barr virus infection
    118675217
   05165 Human papillomavirus infection
    118675217
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    118675217
   05100 Bacterial invasion of epithelial cells
    118675217
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    118675217
   05142 Chagas disease
    118675217
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118675217
   05017 Spinocerebellar ataxia
    118675217
   05020 Prion disease
    118675217
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118675217
   05418 Fluid shear stress and atherosclerosis
    118675217
   05415 Diabetic cardiomyopathy
    118675217
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    118675217
   04932 Non-alcoholic fatty liver disease
    118675217
   04931 Insulin resistance
    118675217
   04933 AGE-RAGE signaling pathway in diabetic complications
    118675217
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118675217
   01524 Platinum drug resistance
    118675217
   01522 Endocrine resistance
    118675217
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmyo04131]
    118675217
Membrane trafficking [BR:mmyo04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    118675217
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 DicA_C ODF2_C
Other DBs
NCBI-GeneID: 118675217
NCBI-ProteinID: XP_036203443
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDNSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELIHHYHHESLAQYNPKLDVKLMYPVSKYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYRKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSFCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagctgttacaaatggaatgaaggacaattctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattat
actttgactttgcggaaaggaggcaataataagttaataaaaatctaccaccgagatggg
aaatacggcttttctgatcctctgacatttaattctgtggtggagctcattcaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccaaataccagcaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaaa
ctgcaggagtatcactctcagtatcaggaaaagagtaaagagtatgacaggctatatgaa
gaatataccagaacatcccaggaaatacagatgaagcggacggcaattgaagcttttaat
gaaacaattaaaatttttgaagagcagtgtcacacacaagaacagtatcgcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcccgtctgggtgagattcatgatagcaaaatgcgtctagaacaagat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacttgatccaactgcgcaagatccgagatcaacaccttgtatggctcaatcacaaagga
gtgagacagaaacgtctaaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaagcctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggaa
gtgaagcactgtgtgatctacagcactgcccggggctatggctttgccgagccctacaac
ctgtacagctcgctgaaggagttggtgctccactaccagcagacgtccctcgttcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcgttctgc
agataa

DBGET integrated database retrieval system