KEGG   Methanococcus maripaludis C7: MmarC7_0671
Entry
MmarC7_0671       CDS       T00553                                 

Definition
(GenBank) deoxycytidine triphosphate deaminase
  KO
K09887  dCTP deaminase (dUMP-forming) [EC:3.5.4.30]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz00240  Pyrimidine metabolism
mmz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    MmarC7_0671
Enzymes [BR:mmz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.30  dCTP deaminase (dUMP-forming)
     MmarC7_0671
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: ABR65738
UniProt: A6VH12
Position
667201..667821
AA seq 206 aa
MILSDKDIFDYVNSKRVLIEPFNSKFVGPCSYDVTLGSEFIKYKEDVYDLKKSLSHNKFE
IENSIMVCPLNHHLDETIIENYKEKYNVDCIVSGGLLGTTNEYVELPNDVCAQYQGRSSF
GRVFLQTHQTAGWIDSGFRGKITLEIVAYDKPVILYKNQRVGQLIFSKSLSPADVGYSDR
KYSKYAGQKSVMASLIKKDFEIDEEE
NT seq 621 nt   +upstreamnt  +downstreamnt
atgatattaagtgataaagacatttttgactatgttaattcaaaaagagttctaattgag
ccctttaattcgaaattcgttgggccttgttcatacgatgtcacacttggaagcgaattt
ataaagtacaaggaagatgtttacgaccttaaaaaaagtttaagtcacaacaaatttgaa
attgaaaactcgattatggtatgtcctttgaatcatcacttggatgaaacaataattgaa
aattataaagaaaaatataatgtcgactgcattgtgagtggcgggcttttagggaccacc
aatgaatacgtggaacttccaaatgacgtttgtgcgcaatatcagggtagaagcagtttt
ggaagagtatttttacagacacaccagactgcgggctggattgattcaggatttagagga
aaaataactttagaaattgtagcatacgataaacccgtaatactttataaaaaccagaga
gttgggcagctgatatttagtaaatcactttcgcctgcagatgtaggttattctgacagg
aaatactcaaaatacgccggacagaaatcagtaatggcttcacttattaaaaaagacttt
gaaatcgatgaggaggaataa

DBGET integrated database retrieval system